KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101964Help
Entry
102101964         CDS       T02921                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00730  Thiamine metabolism
phi00790  Folate biosynthesis
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    102101964
   00790 Folate biosynthesis
    102101964
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102101964
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phi00537]
    102101964
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102101964
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102101964
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phi00537]
 Enzymes
  102101964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 102101964
NCBI-ProteinID: XP_005525236
LinkDB All DBs
Position
Un
AA seq 532 aa AA seqDB search
MAMLDPLGCTWRLPALLSPPDAEKTPSYWNRGARRRLELALALHPAAQRAKNIILFMGDG
MGVSTVSAARIYKGQLAGGSGEESVLAMETFPHVALAKTYTIDRQVPDSAGTGTAYLCGV
KANAKTLGLSGAAIYGKCHTTFGNEVDSVLHRARLAGKSVGIVTTTRVQHASPGAAYAHS
ASRSWYADTNMPKEALRDGCKDIADQLIHNTDINVILGGGRMYMTPKRTPDPEYPEDPDQ
NGTRKDGRDLIAEWLSAKKGARYVWDKKGLDAVKDDSVSHLMGLFEPKDMKYELNRNTST
DPSIVEMTEKAIRILRRNPNGFFLFVEDDHIPLAGGRIDHGHHSGRAKQALMEAVMLDRA
VARAGELTSPADTLTVVTADHSHVFTFGGSTPRGNSIFGLAPKKAKDKRDYTSILYGNGP
GYSIRDGARPAASLPAAEDKDYRQQAAVPLETETHSGEDVVVMAQGPMAHLFHGVQEQHY
IAHAMAYAACLEPYATEPGCRAARRASHGTQCSPQPLLALLALCMAALIVRG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccatgctggaccccttggggtgcacctggaggctcccagctctgctctcacctcca
gatgctgagaagaccccgagctactggaatagaggtgccaggagaaggctggaattggcc
ctggccttgcacccagcagcacagcgggccaaaaacatcatcctcttcatgggtgatggc
atgggggtgtccaccgtgtcagcagctcggatctacaaggggcagctggccggtggctca
ggcgaggagagtgtcttggccatggagacctttccccatgtggccctggccaagacctat
accatcgaccgccaggtgcccgacagcgctggcacgggcactgcctacctctgtggggtg
aaggccaacgccaagactctgggactgagcggggcagccatctatggaaaatgccacacc
acctttggcaatgaggtggactctgtcctgcaccgggccaggctggcgggcaagtctgtg
ggcattgtgacgaccacgcgggtgcagcacgcgtcccccggggcagcctacgcgcactcg
gccagccggagctggtacgctgacaccaacatgcccaaggaggccctgcgggacggctgc
aaggacatcgccgaccagctgatacacaacactgacatcaacgtgatcctgggcggcggg
aggatgtacatgacccccaagcggactccggaccccgagtacccagaggatccggatcaa
aatggcaccaggaaggatggccgggacttgattgcggagtggctgagtgccaagaagggt
gcccgctacgtctgggacaagaagggcctggatgcggtcaaagatgactctgtgagccac
cttatgggcctctttgagcccaaggacatgaagtatgagctgaaccgcaacacatccaca
gacccctccatcgtggagatgacagaaaaggccatccgcatcctgcgcaggaaccccaat
ggcttcttcctctttgtggaagatgaccacattccccttgcaggtggcagaattgatcat
ggccaccacagtggccgggccaagcaggcgctgatggaggccgtgatgctggaccgggcg
gtggcacgggccggcgagctcacctcccccgctgacaccctgaccgtggtgacagccgat
cactcccatgtcttcacttttgggggcagcacaccacgtggcaactccatctttgggctg
gcccccaagaaagccaaggacaagcgagactacaccagcatcctctatggcaatggtcct
ggctacagcatccgtgacggggcccgtccagctgccagcctccctgccgcagaagacaag
gattacagacagcaggcagctgtgcccctggagacagagactcacagtggggaagacgtg
gtggtgatggcccagggccccatggcccacctcttccacggggtgcaggagcagcactac
atcgcccatgccatggcctacgctgcctgcctcgagccctatgccacagagcctggatgc
agggcagcccgcagagcctcccatggcacacagtgctccccacagcccctgcttgccctc
ctggccctctgcatggctgccctcatagtgaggggctaa

DBGET integrated database retrieval system