KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102136Help
Entry
102102136         CDS       T02921                                 

Gene name
ALPI
Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00730  Thiamine metabolism
phi00790  Folate biosynthesis
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    102102136 (ALPI)
   00790 Folate biosynthesis
    102102136 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102102136 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phi00537]
    102102136 (ALPI)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102102136 (ALPI)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102102136 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phi00537]
 Enzymes
  102102136 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 102102136
NCBI-ProteinID: XP_014109738
LinkDB All DBs
Position
Un
AA seq 541 aa AA seqDB search
MGVPREQVSLGCGYPAGVPWGCDSGELGLTDVCTVPAEEEKPSFWNKKAAAAIEASLKIQ
PRRSQAKNLLLFLGDGFGIPSITATRILKAQLQGKLGPETPLALDAFPYVALSKTYSVDR
HVPDSASTATAYLCGVKGNYKTIGVSAAARYLQCNTTAGNEVISVLQRARKAGKSVGIVT
TSRVQHASPSGTYAHVVDRNWYADSSMPQEALQQGCKDIALQLVHNVDINVIMGGGRKYM
SPVGTPDPEYPTDSGQNGIREDGRNLINTWVEARPGARYVWNRTEMLAAAANPSVNYLMG
LFEPGDMKYELVHNATLDPSLSEMTEAAITILSRNPKGFYLFVEDNPPWVPSAGGRIDHG
HHEGAAQKALTEAVEFDRAIERAGTLTDEAETLTVVTADHSHVFSFGGYTLRGSSIFGLA
PKTAIDEKNYTSILYGNGPGYPGTERPNVDQDTAMRFDYLQQAAVPLKSESHGGEDVAIL
AKGPMAHLFHGVQEQTCVAHIMAYAACIEPYTDCRHGNSAPGIRATPLALLLPPLLLPLF
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgcccagggaacaagtatccctggggtgtgggtaccctgcaggggttccctgg
gggtgcgactctggtgagctgggactgacggatgtttgcactgtcccagcggaggaggag
aaaccatccttctggaacaagaaggcagctgcagccattgaagcctccctgaaaatccaa
cccaggagaagccaagctaaaaacctcctcctttttcttggggatggatttgggatcccc
agcatcacagccacccgcatcctaaaggcgcagctgcaggggaagctgggccctgagacc
cctcttgccttggatgctttcccctacgtggctctctctaagacctacagtgtggacagg
cacgtccctgacagcgcgtcgacagccacagcctatctctgcggggtgaagggcaactac
aagaccataggggtgagcgcggccgcccgatacttgcagtgcaacaccacggccggcaac
gaggtgatctcagtgctgcagcgagcccgcaaagctgggaagtcagtgggcatcgtgacc
acgtcgcgggtgcagcacgcgtcaccctcggggacctatgcgcacgtggtggaccggaac
tggtacgcggactccagcatgccccaggaggcgctgcagcagggctgcaaggacatcgcc
ctgcagctggtccacaacgtcgacatcaatgtgatcatgggtggtggtcggaaatacatg
agccccgtgggaacgccggaccccgagtaccccactgacagcgggcagaacgggatacgc
gaggatgggagaaacctcatcaacacgtgggtggaggcacggccgggtgcccgctatgtc
tggaacaggacagagatgctggctgctgcggccaaccccagcgtgaattatttgatgggt
ctgtttgaacctggggacatgaagtatgaactggtacataacgccaccctggacccatca
ctcagtgagatgacagaggcagccatcaccatcctgagcaggaaccccaaagggttctac
ctctttgtggaagataacccaccgtgggtgccatctgcaggtggcagaatcgaccatggc
caccatgaaggcgcagcccaaaaggcactgacggaggcggtggagtttgaccgggccatc
gagcgggcaggcaccctgacagacgaggctgagaccctcactgttgtcaccgctgaccac
tcacacgtgttctcctttggtggctacaccctgcgtggctcctccatcttcggtctggca
cccaagacagccattgacgagaagaactacacatccatcctctacgggaatgggccagga
tacccaggcactgagcgacccaacgtggaccaggacacagccatgcggttcgattacctg
cagcaggcggccgtgcccctcaagtcggagagccatggtggtgaggatgtggccatcctg
gccaagggtcctatggcccacctcttccacggggtgcaggagcagacctgtgtagcccac
atcatggcctacgccgcctgcatcgagccctacactgactgccgccacgggaactctgcc
cctggcatccgcgccacgcccctggccctgctcctccctcccctccttctgcccctcttc
cactga

DBGET integrated database retrieval system