KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102156Help
Entry
102102156         CDS       T02921                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00052  Galactose metabolism
phi00500  Starch and sucrose metabolism
phi01100  Metabolic pathways
phi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102102156 (GAA)
   00500 Starch and sucrose metabolism
    102102156 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102102156 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102102156 (GAA)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102102156 (GAA)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102102156 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 102102156
NCBI-ProteinID: XP_005530765
LinkDB All DBs
Position
Un
AA seq 878 aa AA seqDB search
MGPGPALLALLALLGPAEARGAAAAACEVAPSGRFDCGPERLLSRAGCEARGCCYIPGPG
PRSGPGPPWCFFPRGYRSYRAENLTATESGFSARLRRVAAAFLPAAVDDVRLELALETPA
RLRFTLRDAARQRYEVPLATPRVRGRAPATLYGLRVSQEPFGLVVCRQRGGTVLLNTTVA
PLFFTDQFLQISTSLPSRFISGLGEHLTPLFLDTAWTRVTLWNRDMAPAPHVNLYGSHPF
YLVMEDDGSAHGVFLLNSNAMDVLLQPSPALTWRTTGGILDFYIFLGPDPKSVVRQYLDV
VGFPFMPPYWGLGFHLCRWGYSSTTITRQVVANMTAARFPLDVQWNDLDYADAKRDFTFN
KKSFKDYPEMVRDFHSRGLRYIMIVDAGISSSGPPGTYKPYDEGLKRGVFIRNATGQPLI
GKVWPGPTAFPDFTNPATHEWWHDMVKDFHEQVPFDGMWLDMNEPSNFVEGSQHGCPNNN
LEHPPYVPGVFGGRLQAGTICASSQQYLSSHYDLHSLYGLTEAIASHDALLRVRGKRPFI
ISRSTFSGHGRYAGHWTGDVGSDWEQLYYSIPEVLLFNLFGVPLVGADVCGFMGDTSEEL
CVRWTQLGAFYPFMRNHNDHGTRPQEPYTFSPPAQAAMRNALRLRYSLLPFLYTLFHRAH
TAGETVARPLFLEFPTDPNSWAVDRQLLWGGGLLVTPVLEAGQTKVSGYFPAGTWYSLAG
DSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPTLSTAQSRSKGMALVVALTLDGFAR
GDLFWDDGESWETFERGDYTEILFLASNDAVLSQLLRASPHLDGVLLEAVTVLGVTSPPQ
RVLANGAFVSDFSYRSDTQVLRVPVSLPMWEQFVISWS
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggcccggcgctgctggcgctgctggcgctgctgggcccggccgaggcgcgg
ggcgcggccgctgccgcctgtgaggtggccccgagcggccgcttcgactgcggccccgag
cggctcctgtcgcgggcgggctgcgaggctcggggctgctgctacatccccgggcccggg
ccccgcagcggccccggcccgccctggtgcttcttcccccgcggctaccgcagctaccgc
gccgagaacctgacggccaccgagagcggcttctccgcccggctgcgccgcgtggccgcc
gctttcctgccggcagcggtggacgatgttcggctggagctggcgctggagaccccggcc
cgcctgcgcttcacgctccgggacgcggcccggcagcgctacgaggtgcccctggccacg
ccgcgggtgcgcggccgagcccccgccacgctctacgggctgcgggtcagccaggagccc
ttcggcctcgtggtgtgccggcagcgcggcgggacggtgctgctgaacaccacggtcgca
cccctgttcttcacagaccagttcctgcagatctccacctccctgccctcccgtttcatt
tcggggctgggggagcacctgacaccgctgttccttgacacagcctggaccagggtcacc
ctctggaatcgggacatggcacccgcgccccacgttaacctctatggctcccaccctttc
tacctggtgatggaggacgatggttcagcccacggtgtctttctgctgaacagcaacgcg
atggacgtgctcctgcagcccagcccggccctgacctggcgcaccacaggtgggatcctg
gacttctacatcttcctgggccccgaccccaagagcgtggtgcggcagtacctggatgtg
gttgggtttcccttcatgcccccgtactggggcctgggcttccacctctgccgctggggc
tactcctccaccaccatcacccggcaggtcgtggccaacatgacagcagcccgcttcccc
ctggatgtgcagtggaacgacctggattacgcagatgccaagagggatttcaccttcaat
aagaaaagctttaaggactacccggagatggtgcgggacttccacagccgcgggctgagg
tacatcatgatcgtggatgctggcatcagcagctcggggccccccggcacctacaagccg
tacgacgagggcctgaagcggggggtgttcatccggaacgccacggggcagcccctgatc
gggaaggtctggccgggccccacggccttcccggacttcaccaacccagcgactcacgag
tggtggcacgacatggtgaaggacttccacgaacaagtgcccttcgatggcatgtggctt
gacatgaacgagccctcaaacttcgtggagggctcccagcacggctgtcccaacaacaac
ctggagcatcccccctacgtgccgggtgtatttgggggacgcctgcaggccgggaccatc
tgtgcctccagccagcagtacctgtcctctcactacgacctgcacagcctgtacgggctg
accgaggccatcgcctcccacgatgctctgctgagggtccggggcaagcgtcccttcatc
atctcccgctccaccttctctgggcacggccgctacgccgggcactggacaggagatgtt
ggcagcgactgggagcagctctactactccataccagaggtgctgctcttcaacctcttc
ggggtgccgctggtgggtgccgacgtctgcggcttcatgggcgacacgagcgaggagctg
tgcgtgcgctggacccagctgggcgccttctaccccttcatgaggaaccacaacgaccac
ggcacccggccacaggagccctacaccttcagccctcctgcccaggctgccatgaggaac
gccctgcgcctccgctactccctcctgccgttcctctacaccctgttccaccgggctcac
accgccggcgagaccgtggctcggccgctgttcctcgagttccccacagaccccaacagc
tgggccgtggaccgccagctcctgtggggcggggggctgctcgtcacccccgtgctggag
gcaggacagaccaaagtcagcggttacttcccggcggggacgtggtacagcctggcaggg
gactccaccatccacagcaaagggcagtggatcctcctgccagcccccctggacaccatc
aacgtccacgtccgtgcagggcacatcctgcccctgcaggagcccaccctcagcactgcc
cagtcccgcagcaagggcatggccttggtggtggcgctgaccctggacggcttcgccagg
ggagacctgttctgggacgatggggagagctgggagacctttgagaggggggactacacc
gagatcctcttcctggcctcaaacgacgccgtgctcagccagctgctgcgggcgagcccc
cacctcgacggggtcctgctggaggccgtgactgtgctgggcgtcaccagccctccccag
agagtcctggccaacggcgccttcgtcagcgacttctcctaccgcagtgacacccaggtg
ctcagagtccctgtgtcactgcccatgtgggagcagtttgtgatctcctggtcctga

DBGET integrated database retrieval system