KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102503Help
Entry
102102503         CDS       T02921                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00010  Glycolysis / Gluconeogenesis
phi00053  Ascorbate and aldarate metabolism
phi00071  Fatty acid degradation
phi00280  Valine, leucine and isoleucine degradation
phi00310  Lysine degradation
phi00330  Arginine and proline metabolism
phi00340  Histidine metabolism
phi00380  Tryptophan metabolism
phi00410  beta-Alanine metabolism
phi00561  Glycerolipid metabolism
phi00620  Pyruvate metabolism
phi01100  Metabolic pathways
Module
phi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102102503 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102102503 (ALDH2)
   00620 Pyruvate metabolism
    102102503 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102102503 (ALDH2)
   00561 Glycerolipid metabolism
    102102503 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102102503 (ALDH2)
   00310 Lysine degradation
    102102503 (ALDH2)
   00330 Arginine and proline metabolism
    102102503 (ALDH2)
   00340 Histidine metabolism
    102102503 (ALDH2)
   00380 Tryptophan metabolism
    102102503 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102102503 (ALDH2)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102102503 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 102102503
NCBI-ProteinID: XP_005524349
LinkDB All DBs
Position
Un
AA seq 520 aa AA seqDB search
MLRAVLRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAYNKIFINNEWHDAVSKKTFPSI
NPATGEVICQVAEGDKADVDKAVKAAKAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVANLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGQREGAKLLCGGNPAADRGYFIQPTVFGDVQDNMTIAREEI
FGPVMQILKFKTIEEVIERANDSKYGLAAAVFTKDLDKANFVSQSLRAGTVWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggtgctgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgccgcctcgcccatcccggcgcccaacccgcgccccgacatcgcctataac
aagattttcataaataacgaatggcacgatgcagtcagcaagaaaaccttcccttccatc
aacccagccacgggagaagtcatctgccaggtggctgagggcgataaggcagatgtggac
aaggcggtgaaggcagccaaggcagcattccagctgggctctccctggaggaggatggat
gcatctcaccgggggaagctgctgaaccgtctggctgacctgatcgagagggaccgcgcc
tacctggccgccctggaaactctggataatggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtcggataaattccac
ggcaaaaccatcccgttagacggagacttcttctgctacacaagacatgagccggtggga
gtctgtggacaaatcatcccgtggaacttcccgctgttgatgcaagcgtggaaactgggg
cctgccctggccactgggaatgtggttgtgatgaaggtggcagagcaaacccccctgagt
gctctctacgtggccaatctgatcaaagaggctggattccccccgggcgtggtgaacatc
atccctggctatggccccacggcaggagctgccatctcctcccacatggacattgacaaa
gtggccttcaccggctccacggaggtcggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatatcatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaagggcag
tgctgctgtgccgggtccaggacctacgtgcaggaggacatttacaacgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttgggaacccctttgacttcaaaactgag
cagggccctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcactggg
cagcgggagggagccaagctgctgtgtggtggcaaccccgctgcagacaggggctacttc
atccagcccactgtctttggggatgtgcaggacaacatgaccattgccagggaggagatc
tttgggccggtcatgcagatcctgaaattcaaaaccattgaggaggtcattgagagagcc
aacgactccaagtacggcctggcagccgcggtgttcaccaaggacctggacaaagccaac
tttgtgtcgcagagcctgcgggctgggacggtctggataaactgctacgatgtgtttggt
gcccaggctccctttggtggctacaaagcctctgggaacgggcgggagctgggcgagtac
ggcctggaggcttatgtggaggtgaaaaacgtgacaatcaaaattccacagaaaaactcc
taa

DBGET integrated database retrieval system