KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102573
Entry
102102573         CDS       T02921                                 

Gene name
SMURF2
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04120  Ubiquitin mediated proteolysis
phi04144  Endocytosis
phi04340  Hedgehog signaling pathway
phi04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102102573 (SMURF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102102573 (SMURF2)
   04350 TGF-beta signaling pathway
    102102573 (SMURF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102102573 (SMURF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phi04131]
    102102573 (SMURF2)
   04121 Ubiquitin system [BR:phi04121]
    102102573 (SMURF2)
   03029 Mitochondrial biogenesis [BR:phi03029]
    102102573 (SMURF2)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     102102573 (SMURF2)
Membrane trafficking [BR:phi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102102573 (SMURF2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102102573 (SMURF2)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  HECT type E3
   102102573 (SMURF2)
Mitochondrial biogenesis [BR:phi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    102102573 (SMURF2)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 102102573
NCBI-ProteinID: XP_014111237
LinkDB
Position
Un
AA seq 753 aa
MSNPGARRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCLVDENTPISGTNGASCGQAADPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQHQQQQQVVSLCQ
LPDEAECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRP
KDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAV
NPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMELVDPDLHNSLVW
ILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIE
AQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKANTRLKHCTPDSNIVKW
FWKAVELFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASTNNLPKAHT
CFNRIDIPAYESYEKLYEKLLTAIEETCGFAVE
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgtccaacccaggggcccggcggaacgggcccgtcaagctgcggctgacagtactgtgt
gcaaaaaacttggtgaaaaaggattttttccgacttcctgatccctttgctaaggttgtg
gtggatggatctggccagtgccattctacagatactgtgaagaatacacttgatcccaaa
tggaatcagcattatgacctatatattgggaagtcggattcaataacaatcagcgtgtgg
aatcacaagaaaattcataaaaagcagggagctggttttctgggttgtgtgagacttctt
tcaaacgcaatcaaccgccttaaagacactggttatcagaggttggatctgtgcaagctt
gggccaaatgacaacgacactgttagaggacagatagtagtcagtcttcagtccagagac
cgaataggcacaggaggacaagttgtggattgcagtcggttattcgataacgatttacca
gacgggtgggaggagcgcaggactgcttctggaaggatccagtatttaaaccacataaca
cggacaactcagtgggagcgaccgacacggccagcatccgagtactcgagcccgggcagg
cccctgagctgcctggtggatgagaacactccgatcagcggcaccaacggcgcgtcctgc
gggcaggcggcagatccacggctggccgagaggagggtccgctcccagaggcacaggaac
tacatgagcagaacacacctgcacactcctcctgacctacctgaaggatatgagcaaagg
acaactcagcaaggtcaggtctattttctgcatactcaaactggtgtgagcacgtggcac
gatccaagagttcctagggatcttagcaacatcaattgtgaagagcttggtccactgcct
cctggatgggagatccgaaatacagcaacaggcagggtttattttgttgaccataacaac
aggacgacgcagttcacggacccgcggctctctgcaaacctacacttggtcctaaatcgg
cagaaccagctcaaggaccagcagcaccagcagcagcagcaggtggtgtccctgtgccag
ctcccggacgaggccgagtgcctgacggtgccgcgctacaagcgggacctggtgcagaag
ctcaagatcctgcggcaggagctgtcccagcagcagcctcaggctggccactgtcggatc
gaggtctccagggaggagatttttgaggaatcctacaggcaagtcatgaagatgaggcca
aaggacctgtggaaacgattaatgataaaatttcgtggggaggaaggccttgattatgga
ggtgttgccagggagtggctgtacttgttgtcccatgaaatgctgaatccatactatggg
ctcttccagtattcccgagatgatatctacaccctgcaaatcaaccctgactctgctgtc
aacccggaacacttgtcctatttccactttgtgggccggatcatggggatggctgtgttc
catgggcactacattgacgggggcttcacgttgcctttctacaagcagttgcttgggaag
ccaattacattggatgacatggaattggttgaccctgatctccataacagcttagtttgg
atacttgagaatgacatcaccggggtcctggaccacacgttctgtgtggaacacaacgcc
tacggggagatcattcagcacgagctgaaacccaatggcaaaagcatccccgtgacagag
gagaacaaaaaggagtatgtcagactttatgtgaactggcggtttttacgaggaattgaa
gctcaattcctggcgctccagaagggatttaatgaagtaatcccacaacatctgctgaag
acatttgatgagaaggagttagagctcattatttgtggactgggaaaaattgatgttaat
gactggaaggcaaataccaggttaaaacactgtaccccggacagcaacatcgtgaaatgg
ttctggaaagctgtggagctcttcgatgaggagaggagggcgcggctgctccagttcgtg
accggctcctctcgggtgcctctgcagggcttcaaggcactgcaaggtgctgccggccca
cgactcttcacaatacaccagattgatgccagcactaataatttgccgaaagctcatacc
tgcttcaacaggatcgacattcccgcgtacgagagctacgagaagctctacgagaagctg
ctcacggccatcgaggagacctgtggctttgctgtggaatga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107051
Entry
102107051         CDS       T02921                                 

Gene name
SMURF1
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04120  Ubiquitin mediated proteolysis
phi04144  Endocytosis
phi04340  Hedgehog signaling pathway
phi04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102107051 (SMURF1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102107051 (SMURF1)
   04350 TGF-beta signaling pathway
    102107051 (SMURF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102107051 (SMURF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phi04131]
    102107051 (SMURF1)
   04121 Ubiquitin system [BR:phi04121]
    102107051 (SMURF1)
   03029 Mitochondrial biogenesis [BR:phi03029]
    102107051 (SMURF1)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     102107051 (SMURF1)
Membrane trafficking [BR:phi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102107051 (SMURF1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102107051 (SMURF1)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  HECT type E3
   102107051 (SMURF1)
Mitochondrial biogenesis [BR:phi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    102107051 (SMURF1)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 102107051
NCBI-ProteinID: XP_005523251
LinkDB
Position
Un
AA seq 729 aa
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPTDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPA
PYTDTTGAAGGGGCRFLESPSQDQRLQAQRLRTPEVRAHVQTPQNRPHGHQSPELPEGYE
QRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDH
NNRTTQFTDPRLHHIMNHQCQLKEPSQQPLPAPNEGSLEEGEELPAQRYERDLVQKLKVL
RHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAR
EWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHY
INGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRI
LQHELKPNGRNIPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQ
KELELIIGGLDKIDLNDWKSNTRLKHCMADSNIVKWFWQAVETFDEERRARLLQFVTGST
RVPLQGFKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAV
EETCGFAVE
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcgaatcccggtacccgccggaacggatccagtatcaagatccgcctcacagtatta
tgtgccaagaatctcgcaaagaaagatttcttcagacttcctgacccatttgctaaaata
gttgtggatgggtcaggtcagtgccattccactgacactgtgaagaacacgttggacccc
aaatggaatcagcattacgatctatacgttgggaaaacagattccataaccatcagtgta
tggaaccataaaaaaatccataagaaacagggagctggcttcctggggtgtgtccgtctt
ctctccaatgccatcagcaggctgaaagatactggataccagcgtttggatctatgcaaa
ctcaaccccacagacaccgatgctgtccgaggccaaatagtggtcagtttacagacacgg
gacagaataggcacaggaggttctgtagtagactgcagagggcttttggagaatgaagga
acggtttatgaagactctgggccggggaggccgctgagctgcttcatggaggagccagcc
ccgtacacggacacgacgggagcggcaggaggaggcggctgccgcttcctggagtctccc
agccaggaccagaggctccaggcccagcggctccgcacccccgaggtcagagctcacgta
cagacacctcagaacaggccccatggccaccagtcacctgagctacctgaaggctacgag
caaaggacaacggtacagggacaggtttattttttgcacacacagactggagtgagcacg
tggcatgacccaaggataccaagagaccttaacagtgtgaattgtgatgaactgggacct
ttgcctccaggctgggaagtcaggagtacagtttcaggaagaatatattttgtagatcat
aacaacagaaccacacaattcacagatccacgactacatcacatcatgaaccatcaatgc
cagctaaaagagcccagccagcagcctctaccagctccaaatgagggatcattggaagag
ggtgaggagttgcctgcacagagatatgaaagagacttggtacaaaagttgaaagttctt
agacatgagctctctcttcagcaacctcaggctggtcactgtcgcattgaagtatccaga
gaggaaatatttgaggaatcctatcgtcagataatgaagatgaggccaaaggacttgaaa
aagaggcttatggtgaaattccgaggagaggaaggcctggactatggaggagtagcaaga
gagtggttgtatttactgtgccatgaaatgttgaatccctactatggactcttccaatac
tccacagataatatttatatgctgcaaatcaatccagactcttctatcaatcctgaccat
ttgtcttatttccattttgttggtcggataatgggtttggctgtgttccatggacactat
atcaacggggggttcacagttcccttttacaaacagctgctggggaagcctatccagctc
tccgatctggaatctgttgacccagaattacacaaaagtttagtctggatcttagagaac
gatatcacaccagtcttggatcatacattctgtgtggagcacaatgcctttgggaggatt
ttacagcatgaactcaaaccaaatggcaggaatattccagtgacagaagagaacaagaag
gaatatgtcagattgtatgtgaactggcggttcatgagaggaatagaggcacagttcctg
gctctgcagaaaggctttaatgaacttattcctcaacatcttctcaagccttttgaccag
aaggaacttgagctgatcataggaggcctggataagatagacctgaatgactggaagtcc
aacacccgcctaaagcactgcatggctgacagcaacatcgtcaagtggttctggcaagcg
gtggaaacgtttgatgaggaaagaagggcaaggctgctgcagtttgtgacgggctcgacg
cgtgtcccacttcaaggtttcaaggctttacaaggcgctgcaggacccagactgtttacc
atccatttaatagatgcaaacacagacaaccttccaaaagcccacacttgctttaaccgg
atcgacattccgccttatgagtcatatgagaagctttatgagaagctgttgacagctgtg
gaagagacgtgtgggtttgctgtggaatga

DBGET integrated database retrieval system