KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102768Help
Entry
102102768         CDS       T02921                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04110  Cell cycle
phi04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102102768 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102102768 (HDAC1)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102102768 (HDAC1)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102102768 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102102768 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102102768 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102102768 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102102768
NCBI-ProteinID: XP_005529817
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MALTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQPIPEDAIQEDSGDEEEDDPEKRISIRNSNKRISCDEEF
SDSEDEGEGGRKNVANFKKAKRVKAEEEKEEEEKKDEKEEEKVKEEKAAAEPKGVKEETK
ST
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacgcagggcacgaagcgcaaagtctgctactactacgatggggatgttggg
aattattattatggccaaggacatcccatgaaaccccacaggatccgcatgacccacaac
ctcctgctcaactatgggctctacaggaagatggagatctatcgtcctcacaaagccaat
gcagaggagatgaccaagtaccacagcgacgattacatcaaattcctgaggtccatccgc
cctgacaacatgtctgagtacagcaagcagatgcaaagatttaatgttggggaggattgc
cctgtgtttgatgggctctttgagttctgtcagctctctgctggaggctctgttgccagt
gctgtgaagctgaacaagcagcagacggacatcgcagtgaactgggcaggaggtctccac
cacgccaaaaaatcagaagcttctggtttctgctacgtcaacgacatcgtcctggccatc
ctggagcttctcaagtaccaccagcgggtgctgtacattgacatcgacatccaccacggg
gatggggtggaggaggctttttacaccacagaccgagtcatgaccgtgtccttccacaaa
tatggagaatatttcccaggaactggggacctgagggacattggggcaggcaaagggaag
tactacgctgtcaattacccgctgcgggacggcatcgacgacgagtcctacgaagccatt
ttcaagcctgtgatctccaaagtgatggagacgttccagcccagcgccgttgtcctgcag
tgcggctccgattccctgtctggggacaggttgggctgcttcaacctgaccatcaaaggc
catgccaagtgcgtggagtttgtgaagagctttaacctgcccatgctgatgctgggagga
ggggggtacacgatccgcaacgtggcccgctgctggacctacgagactgctgtggctttg
gacactgagatccccaatgaacttccatacaacgactactttgagtactttgggccagac
ttcaagctccacatcagcccctccaacatgaccaaccagaacaccaacgaatacctggag
aaaatcaagcagcggctcttcgagaacctgaggatgctccctcacgctcccggggtccag
atgcagccaattcctgaggatgctatccaggaggacagcggggatgaggaggaggacgat
cctgagaaacgcatttccatccgaaattccaacaagagaatatcctgcgatgaggaattc
tccgactccgaggacgagggcgagggagggcgcaaaaacgtcgccaacttcaagaaagcc
aaacgtgtgaaagcagaggaggagaaggaggaagaggagaagaaagatgagaaagaagag
gaaaaagtaaaagaggaaaaagcagcagcagaacccaaaggggtgaaggaagaaacaaaa
tccacttga

DBGET integrated database retrieval system