KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103693
Entry
102103693         CDS       T02921                                 

Gene name
CDON
Definition
(RefSeq) cell adhesion associated, oncogene regulated
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102103693 (CDON)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig V-set C2-set_2 Pur_ac_phosph_N Izumo-Ig Ig_5 Tissue_fac EphA2_TM
Other DBs
NCBI-GeneID: 102103693
NCBI-ProteinID: XP_005528501
LinkDB
Position
Un
AA seq 1250 aa
MHPAPRRFQALLLIAATSLVTATSTDLTPCFISEPSSTVQKSGEPVQLRCSAEPSSAHIS
WLFNGEPLDSRVGEVEIQSGSLTIVSLSPETCGRYQCVASSSVGAVLSQPATVSMGSLAD
FDALGMAAVAAEEGGTALIRCKVPESHPKAQVRFQVRGKWLEQSTGNYLILPSGNLQILN
VSLEDKGSYRCAVYNPVTHDLRVELTGRKLTVTRPSSGGSQILHPLAPQSLAVPRHSALT
LECVVSGSAPAPIRWLKDGRDVLRRGRWKLLHSHLVTDRLEPSDAGNYSCVVGSDSATLK
YVNYSLTVLEPASLSRGLQDETVAAGASVHFWCDVGGSPAPALTWLHNAAPLRPSPRHFP
SGNHLRICGVTLEDSGLYQCVANNGIGFVQSTGRLRVQPGKDSVPIIISSPANTTVVTGG
DVTLSCNATGLPAPLIRWYDSRGLVIGQQGLHPKAQSPPRAGPEPSCPSVPRVGWGSLRL
RAVTPERAGEFRCEASNEHGSALSTAFLTVLPSATGTRAGETAPLELAQSNESGGDFGAE
MAFSSSPPTKSPLDAAAMEKASSAAAPPEAPIILSPPQTPKPDTYSLVWRPGRAGGLPIN
AYFVKYRKLEDGVSAAGGWHTVRVPGSENELRLTELEPSSLYEVLMVARSAAGEGQPAML
TFRTSKERTSPSKNTQAPSPPVGIPKHPIVHEGTNNFGVILPDLSRHSGVPEAPDRPTIS
TASESSVYVTWIPRANGGSPITAFKVEYKRLGRNSDWLVAAGNISPSKLSVEVRNLEPGE
MYRFRVIAVNNYGESPRSAASRPYQVAGFSGRFSSRPIAGPHIAYTEAISDTQIMLKWTY
ITSSNNNTPIQGFYIYYRPTDSDNDSDYKRDIVDGTKQWHLINHLQPETSYDIKMQCYNE
GGESEYSNVMICETKVKRTPGASEYPVRDLSTPPNPPERAGGSGAVPASGPVRSSDMLYL
IVGCVLGVMVLILIVFIAMCLWKNRQQNAMQKYDPPGYLYQGADINGQMIEYTTLPGTSR
VNGSIHGNFLSNGLSNGCPHVHHKVANGVNGIMSGGGAGLYPGHTNSLSRTHVDYEHPHH
LVNGGGLYTAVPQADPSECISCRNCRNNNRCFTKTNGTFGSSALPVVPLGAPFQQDGVEM
KPLSPHVMVAMCLASATPECSTRLEEEGRESAEQPPAQHPCCREGMSQLSVDCMDGGSCV
HSETSNHILSWSPLILQPVSKDCKEKPGWSSSGVTLNGSGDLCQLQLRET
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgcatccagcccccaggcgcttccaggcactgctgctcattgctgccaccagccttgtc
actgccaccagcacagatttaactccctgttttatttctgagccctcatctactgtccag
aagtctggtgagcccgtccaactccgctgctcggccgagccctcctcagctcacatttct
tggctgtttaatggggagcctctggacagcagggtgggagaagtggaaatccagtcagga
tctttgacaatcgtgtccctgagcccggagacgtgtggacgctatcagtgcgtggcgagc
agcagcgtgggagctgtgctgagccagccggccacggtgtccatgggcagtttagctgac
tttgatgctttggggatggctgctgttgcagcagaggaaggaggcacagctctcatcagg
tgcaaggtaccagaaagtcaccccaaagcacaggttcgcttccaagtgcgggggaaatgg
ctggaacaatcaacaggcaactacctaattcttccatctggaaacctgcaaattttgaat
gtatctttagaagacaaaggttcctacaggtgtgcagtgtacaacccagttactcacgac
ctcagagtagaactcactggacggaagctcacagtcacacgcccttcttcaggtggctcc
cagatccttcacccgctggctccccagagcctggcagtgcccaggcacagcgccctgacc
ctggagtgtgtggtcagtgggtcagctccagcccccatccgctggctgaaggatggccgg
gatgtcctgaggagaggcaggtggaagctgctgcactctcacctggtgacggaccggctt
gagccttcggatgctggaaattactcctgcgtggtgggaagtgactctgcaacactgaaa
tatgttaactattcgcttactgtacttgaacctgcctcgctctccagggggctgcaggat
gaaactgtggctgctggagcgagcgtccatttctggtgtgacgttggtggcagccctgct
cctgccctcacctggctccacaacgctgctcctctccgtccctccccacgacatttcccc
tcggggaaccacctgcggatctgtggggtcaccctggaggactctggcttgtaccagtgt
gtggcaaacaatggaattggatttgtgcagtccacagggagactccgtgtccagccaggc
aaagactctgtccccatcatcatctcttccccagccaacaccactgtggtgactggtggg
gacgtgaccctgtcctgcaatgccaccggcctgcccgctcctctgatccgctggtacgac
agcagaggcctcgtgatcggccaacaggggcttcaccccaaagcacagagccccccccgg
gcagggccagagccctcctgcccctcggtgccccgggtgggctggggctccctgcgcctg
cgggccgtcacccctgagcgcgccggcgagttccgctgcgaggccagcaacgagcacggc
tctgccctgtccacagccttcctcacagtccttccttcagcaactggcacgagagcagga
gaaacagctcctctggagcttgcccagagcaacgagagcggcggtgattttggtgcagaa
atggcattttcaagctcgcctccgacaaaatctcctctggacgcggccgcgatggaaaag
gcgtcgagcgcagcggccccgcccgaggcccccatcatcctgagccccccgcagacgccg
aagccggacacgtacagcctggtgtggcggccgggccgcgccgggggcctgcccatcaac
gcctactttgtcaaataccgcaagctggaggacggcgtgagcgcggcgggcggctggcac
acggtgcgagtgcccggcagtgagaacgagctgcgcctcaccgagctggagccctccagc
ctctatgaagtgctgatggtggccaggagcgccgccggcgagggccagccggccatgctg
acgttccgcaccagcaaggaaagaacatcaccctcgaaaaacacacaggctccatctcca
cctgtgggaatccccaaacatcccattgttcatgaaggcacaaataattttggtgtcatc
cttccggacctgtctcgccacagtggagttccagaagctcctgaccgacccacgatatcc
acggcatcggaatcatccgtctacgtcacgtggatcccccgtgccaacgggggctccccc
atcactgccttcaaagtggagtacaaacgtctgggtcgcaacagcgactggctcgtggca
gctggcaacatctctccctccaagctgtctgtggaagttcggaacttggagccaggagaa
atgtataggttccgagtgatcgcagtgaacaactatggggagagcccgcggagcgcggcg
tcgcgcccgtaccaggtggccgggttcagcggccgcttctccagccggcccatcgccggc
ccgcacatcgcctacaccgaggccatcagcgacacccagatcatgctgaaatggacgtac
atcacatcgagcaacaacaacacgcccatccaaggattttatatctattaccggcccacg
gacagcgacaacgacagcgactacaagcgggatatcgtggacggtacaaagcagtggcac
ctgataaatcacctgcagcctgaaacttcttatgacatcaagatgcagtgctataacgag
gggggagagagtgagtacagcaacgtgatgatctgcgagaccaaagtgaaacgcacgcca
ggagcgtctgaatatccagtgagggacctgagcacgccacccaacccccccgagcgggcc
gggggcagcggggccgtgcccgccagcggccccgtgcgcagcagtgacatgctgtacctg
attgtgggctgtgtgctgggggtcatggtcctcatcctcattgtcttcatagccatgtgc
ctctggaagaaccggcagcagaacgccatgcagaaatatgaccctcctggctacctctac
caaggggcagatatcaacgggcagatgattgagtacacgaccttacccgggaccagccga
gtcaacggcagcatccacggaaacttcctcagcaacggcctcagcaacggctgcccccat
gtccatcacaaagttgccaatggtgtcaatgggatcatgagtggaggaggagcaggactg
tacccagggcacaccaactccctgtccagaacacacgtggactacgaacatccccatcac
ctcgtgaacggtggtgggctgtacacggcagtgccgcaggctgacccctcggagtgcatc
agctgccggaattgtcggaacaataacaggtgtttcaccaaaaccaacggcacttttggc
agcagcgcgctgcccgtggtgcccctcggagcccctttccagcaggatggtgtggagatg
aagcccctgagcccccatgtgatggtggccatgtgcctggcctcggccacccccgagtgc
agcacccggctggaggaggagggcagggagagcgcggagcagcccccggcgcagcatccc
tgctgtcgcgagggcatgagccagctctctgtggattgcatggacggcggcagctgcgtg
cactcggaaacatcgaaccacattttgagctggagtcccctcattcttcagcctgtttcc
aaggactgtaaggaaaaaccaggatggagttcatcaggagtcaccctaaatggttctggg
gacctttgtcagctccagctgcgggaaacctga

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104518
Entry
102104518         CDS       T02921                                 

Gene name
GAS1
Definition
(RefSeq) growth arrest specific 1
  KO
K06232  growth arrest-specific 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102104518 (GAS1)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 102104518
NCBI-ProteinID: XP_005522799
LinkDB
Position
Un
AA seq 322 aa
MVARSPARHGGGGRRWPRAAAWLWLAAALGAVWPPRGSLVQGRRLICWQAVLQCQGEPEC
SYAYNQYAEACAPVLLQQQPPAAGGGDGQAGAGGAAASSKRRCPSHCIAALIQLNHTRRG
PALEDCDCAQDENCRATKRAIEPCLPRTSSPAGGGPGPGGPGVMGCTEARRGCDWGSRCS
LALNRYMTYCGKLFNGLRCTPECRAVIEDMLAVPKAVLLNDCVCDGLERPICESVKENMA
RLCFGADMGGNGAGSSGGSDGGLEEYYYEDYEEEPSQKGRDDAEDNAGAEPGFPVQADNA
GRPAGAVGALLASILVPLLPRL
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtggcccgctcgcccgctcggcacggaggcggcggccggcgctggccgcgggcggcc
gcctggctgtggttggcggcggcgctgggcgccgtgtggccgcctcggggctctctggtg
cagggccggcggctgatctgctggcaggcggtgctgcagtgtcagggggagcccgagtgc
agctacgcgtacaaccagtacgccgaggcgtgcgccccggtgctcctgcagcagcagccg
ccggcggcgggcggcggggacggccaggcgggcgctggaggcgcggccgcctcgtccaag
cggcggtgccccagccactgcatcgcggcgctcatccagctgaaccacacgcggcgtggc
ccggcgctggaggactgcgactgcgcgcaggacgagaactgccgcgccaccaagcgcgcc
atcgagccttgcctgccccgcaccagcagccccgcgggcggcggccccggccccggcggc
cccggcgtcatgggctgcacggaggcgcggcggggctgcgactggggcagccgctgcagc
ctggcgctgaaccgctacatgacctactgcgggaagctgttcaacgggctgcgctgcacg
cccgagtgccgcgccgtcatcgaggacatgctggccgtgcccaaggccgtgctgctcaac
gactgcgtctgcgacgggctggagcggcccatctgcgagtcggtcaaggagaacatggcc
cgcctctgcttcggcgccgacatgggcggcaacggtgcgggcagcagcggcggctcggac
ggcggcctggaggagtactactacgaggactacgaggaggagccgagccagaaggggagg
gacgacgcggaggacaatgcgggcgccgagcccggcttccctgtgcaggcagataacgcc
ggccggcccgccggcgcggtcggggcgctgctcgcctccatcttggtgccgctactgccg
cggctctag

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112245
Entry
102112245         CDS       T02921                                 

Gene name
BOC
Definition
(RefSeq) BOC cell adhesion associated, oncogene regulated
  KO
K20020  brother of CDO
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102112245 (BOC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig ISET-FN3_linker V-set Pur_ac_phosph_N C2-set_2 Ig_4 Ig_5 C1-set Na_Ca_ex
Other DBs
NCBI-GeneID: 102112245
NCBI-ProteinID: XP_005523980
LinkDB
Position
Un
AA seq 1106 aa
MAMTRGRKRPMSPIPCLMLAAASCFAKLSESLQVTVHPASIVQKLGGPVSLGCVVDPPRV
NLTWRLNGKELAGSDEMLGIHVERGKLIITALNNRTVGRYQCIARVPEGVIASVPAVVTL
ANLKDFKFDGQHVIEVDEGNTAVIACDLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGN
LQIVNASQEDEGTYKCAAYNPVTQEVKTSVSSERLRVRRSTAEAARIIYPPEAQTIIVTK
GQSLILECVASGIPPPRVTWAKDGSGVSAYNKTRFLLSNLLIDPTSEEDSGTYSCTADNG
VGEAGAAFIFYNVQVFEPPEVTMELSQQIIPWGQSAKFTCKVRGNPQPSVMWLRNAVPLS
GSHRLRLSRRALRLLSVGPEDEGIYQCMAENEVGSAQAMVQLRTARPGAPLNPGRDAQPD
SAQPPTPPSRDSTLKLPLDKAGLPKPETTPLAASPQCTANKELVTPAEAPIILSSPRTSK
TDSYDLVWRPRPDSRAPILYYVVKHRKQVTNASDSWAVRDVPASQHRLTLTRLDPGSLYE
VEMAAHNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGTSTQSSNQADNSRLSPP
EAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKLGDWVLATRDIPPSRLSV
EIPGLEKGTSYKFRVRALNILGESEPSAASRPYVVSGYSNRVYERPVAGPYITFTDAINE
TTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDVVEGDRYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKSLGLPGRLPPSTVPPQQRPPLSGGHSGLGTGAM
VARSSDLPYLIVGVVLGSIVLLIVAFIPFCLWRAWSKQKQTIDMSFPGAGLLVSSCQYTM
VPLRGISAPRANGHPFVNGQPYASRAHLNGICASAGVGYTSTKPRDYSPDEVPQSQEETN
ALLQARVLQNGSAQQDYQPSRLPSSRTEDSSFLYSLPDDSTHQLLHPQDDCPHLQEHFVG
LHHPVMGSKVGGPSLDARRDTLFHQGSPCCLGLVPVEEVERLDCCQSRGDLHAQNPAITA
LGQDLPRHLNSSPPPLRPSETHPPTS
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggcaatgacacgtggaaggaagaggcccatgtcccccatcccttgcctcatgcttgcg
gctgccagctgttttgccaaactgagtgaatctctgcaggtcacagtgcatcctgcttct
attgtccaaaaacttgggggcccagtcagcctgggctgtgtggtggatcccccccgagtg
aacctcacgtggagactgaacgggaaggagctggctggatcagacgagatgctgggtatc
cacgtggagcgagggaagctcatcatcacggctctcaacaaccgcactgtggggagatac
cagtgcatcgctcgtgtgcctgaaggagtcattgccagtgtccctgcagtggtcacctta
gctaatctcaaagatttcaagtttgatggccagcatgtgattgaggtggatgaagggaac
acagccgtgattgcctgtgacctgcctgaaagtcaccccaaggctcaggtccgctacagt
gtgaagcaggagtggctggaggcctcccgagacaattatcttatcatgccatctgggaac
cttcagattgttaatgccagccaggaggatgaggggacttacaaatgtgctgcctacaac
cccgtgacacaggaggtgaaaacttcagtctccagtgagaggctccgtgtgagacgctcc
acagcagaggcagcccggataatctaccctcctgaggctcagaccatcattgtcaccaag
ggccagagcctcattctggagtgtgtggccagcgggatccccccaccacgggtcacctgg
gccaaggatggctctggagtctccgcctacaacaagacgcgcttcctgctcagcaacctc
ctgatcgaccccacgagcgaggaggactcgggcacctacagctgcacggctgacaatggc
gttggggaggccggggctgcgttcatcttctacaacgtgcaggtgtttgaacccccggag
gtcaccatggagctgtcccagcagatcattccctggggccagagcgccaagttcacgtgc
aaggtgcgagggaacccacagccctcggtgatgtggctgcgcaacgcggtgccgctgtcg
ggcagccaccggctgcggctgtcgcgccgggcgctgcggctgctcagcgtggggcccgag
gatgagggcatctaccagtgcatggccgagaacgaggtgggcagtgcccaagccatggtg
cagctgaggacagcccggccgggagctccactcaaccccgggcgagatgcccagccggac
tcggctcagcctccaactccaccttccagggacagcaccttaaagctgcccttggataaa
gctggactgccaaagcctgagacaacccctctagcagcatctccacagtgtacagccaac
aaggagctggtgactccagccgaagcccccatcatcctcagttctccacggacatccaag
acggacagctatgacctggtgtggagaccccggcctgacagcagagcccccatcctctat
tacgtggtgaagcatcgcaagcaggtcaccaacgcctcggacagctgggccgtgagggat
gtcccagcctcgcagcaccgcctgaccctcaccaggctggaccctgggagcctctacgag
gtggagatggctgctcacaactgtgctggcgagggacagacggccatggtgaccttccgc
accggccggcgcccaaagccagagattgttgccagcaaagagcagcagatccagagggat
gacccaggcacgagcactcagagcagtaaccaggccgacaacagccgtctgtcccctcca
gaggcaccagaccgtccaaccatctccatggcatcagagacatctgtgtatgtgacctgg
atcccccgtgggaatggtgggttccccatccagtctttccgcgtggagtataagaaattg
aagaagttgggagactgggtcctggccaccagggacattcctccctctcgcctctctgtg
gaaatcccaggcctggagaaaggcacatcctataaattccgtgtccgggcgctgaacatc
ctgggagagagcgagcccagcgcagcgtctcggccgtacgtggtgtctggctacagcaac
cgcgtctacgagcgccccgtggccgggccctacatcaccttcacggacgccatcaacgag
accaccatcatgctcaagtggatgtacatcccagccagcaacaacaacactcccatccat
ggattttatatctactaccgccccactgacagtgacaatgacagcgactacaagaaggac
gtggtggaaggagatcggtactggcactccatcagccacctgcagccagagacctcgtat
gacattaagatgcagtgcttcaatgagggaggcgaaagcgagttcagcaacgtgatgatc
tgtgaaaccaaagctcggaagtctcttggtctgccaggtcgtcttccaccctccacagtg
ccccctcagcagcgtcccccactcagtggtgggcacagtggcctggggacaggagccatg
gtggctcgttccagcgacttgccatacttgattgtaggcgttgtactgggatccatcgta
ctcctcatcgtggctttcatccccttttgcctttggagagcttggtccaagcagaaacaa
accattgacatgagcttcccaggagctgggctgctggtgtcatcctgccagtacaccatg
gtgccactgagaggcatctctgctcctcgtgccaatggacatccctttgttaatgggcag
ccctatgccagcagggcacatctgaatggcatctgtgcctctgcaggagtggggtacaca
agcaccaagccccgagattacagcccagatgaagtgccacagtcacaggaggagaccaac
gccttgctgcaggcaagagtgctgcagaatgggagtgcccagcaagactaccagccctcc
agattgcccagctccagaacagaagacagctctttcctctacagtctcccagatgactcc
actcaccagcttcttcacccacaagatgactgtcctcaccttcaagagcactttgttggc
ctccatcatccagtgatgggaagcaaagtgggaggccctagcctggatgctcgacgggat
accctcttccaccaaggaagcccatgctgcttaggcctagtgccagttgaagaggtagaa
agactagattgctgccagtccagaggagatctccatgcccagaatccagcgatcacagct
ttgggtcaggacctaccaagacatctgaacagcagccctccaccactgagaccctcagag
actcatcctcccaccagctag

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112858
Entry
102112858         CDS       T02921                                 

Gene name
LRP2
Definition
(RefSeq) LDL receptor related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102112858 (LRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phi04131]
    102112858 (LRP2)
Membrane trafficking [BR:phi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    102112858 (LRP2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF SGL EGF_CA
Other DBs
NCBI-GeneID: 102112858
NCBI-ProteinID: XP_014104661
LinkDB
Position
Un
AA seq 4661 aa
MDGRAATACKLLILFTACIMQGSCQGCERGQFRCGNGRCIPADWRCDGARDCSDDTDEAG
CPQPTCEGNQFQCHTDGECIPQSWVCDDEEDCEDGSDEHQQCPGRTCSSQQFTCSNGQCI
PSAYWCDRVEDCTDGTDERVCHYPRCEQLSCANGACFNASQRCDGKVDCRDSSDEANCTH
GCTSTQFQCANGECIPRAFICDHDDDCGDRSDENSCTYATCRGNFFTCPSGRCIHQSWIC
DGDDDCEDNEDERGCESGRHECYPGEWACPGSGHCIPIGKVCDGAADCPEGEDETNITAG
RHCNVSRCAALSCQYRCHSSPSGGMCYCPAGYTISNNDSRTCTDFDDCQMWGVCDQLCED
RVGHHQCHCVEGYFLEHHRHCRANTSAGVASIIFSNGRDLLIGDLYGRNFRTLVQSQNRG
IAVGVDFHFYLHRIFWTDTVQDKVFSINIDGSDFQEVLNISVDTPENLAVDWVNNKLYVV
ETSVNRIDMVNLDGTNRVTLIAENLGNPRGIALDPTVGYLFFSDWDSLSGDPKVERAFMD
GTNRQDLIKTKLGWPAGITLDIVSKRLYWVDSRFDYIETVTYDGLQRRTVAHGGSLIPHP
YGITLFEHNVYFTDWTKMAVVKANKFSESNPQVIYQSSLRPYGVTVYHAARQPFARNPCG
SNNGGCEQVCVLSHKTDNDGLGYRCRCILGFDLHVDGRHCVAVRQFLLFSSQMAVRGIPF
NLSTQEDVIIPVTGSPSYFVGIDFCAQDGTIFFSDTSKDMIYKQKTDGSGREILTANRVE
SVEDLAFDWISKNLYWTDPRYRSISVMRLADKSRRAIVQNLNNPRSIVVHPVIGYIFWTD
WFRPAKIMRAWSDGSHALPIVNTTLGWPNGLAIDWSSLRLYWVDAFFDKIEHSTFDGLDR
RTLEHITQMTHPFGLTIFGGYAYFTDWRLGGIVRVRKSDGGEMTIIRRGISNIMHVKAYD
AHSQIGSNYCNRGTNPNGDCSHFCFPVPNFQRVCGCPYGMKLAPNQLTCVEDPSNEPPTL
QCGSYSFSCGNGRCVPLYYQCDGVDDCHDNSDEQNCGSLNNTCASSAFTCASGQCIPGRW
HCDKHNDCFDGSDELHCPTQEPSSCPATQFTCDNRRCIPRIWLCDTDNDCGDGSDEKNCT
FTGTCEPRQFQCPDHRCIDPFYVCDGDKDCIDGADEHDCIYNCSATEFKCLSGDQCISTY
YHCDGVFDCNDHSDEADCPTRPPGMCHQNEFQCQSDGSCVPDNWECDGHLDCADGSDEHH
RCPARTCPPSLFRCDNGNCVYRAWICDGDNDCRDMSDERDCPTQPFRCPSWQWQCPGHSI
CVNLSKVCDNSADCPNGADESPLCNEPQPDQESCSDNNAGCTHECIQGPFGAQCTCPIGY
QLANDSKTCEDINECDPPGFCSQHCYNERGSFRCYCDEGYILEANGRTCKAAESGNLLLL
VASRNQIVVDNITSQSHSIYSLVRDGTNIVAIDFDSITDRIFWSDTTQDKIWSAYKNGTD
RKIVFDSGVTVTESIAVDWVGRNLYWTDFVLETIEVSNMDGSHRTVLISENITNPRGLVL
DPRTDAHVMFWTDWGQNPRIEKASMDGKMRSVIINNKIYWPNGLSIDYPNKLLYFADAYL
DYIDFCDYNGNNRRQVVASDLILQHPHGLTVFEDFVYWSDRYTNRVIRANKWHGGNQTVM
IYNIHQPLGLVAVHPVKQPNGINSCASSPCSHLCLLSSSGPLFFSCACPSGWLLSPDNRN
CMRVEHPFLIAVRENIIYGISLNPEEKTNDAMVPIAGVQNGVDVDFDDSEQMIYWVENPG
EIHRVRSDGANRTVFAPAAVIGAPLGLALDWISANLYYSNPGTQSIEVLKLHGDIMYRKT
LITNDGTSLGAGTPIGLAVDPARGKLYWTDQGTDSGVPAKIASSNMDGSSIQTLFTGSLD
HVEFLTIDIKEQKLYWAVTSTGMIERGNVDGTNRVTLVVHLSHPWGVAVYGTFLYYTDRD
YEVIERVDKATGANKVVLRDNVPRLKSLRVYYRDNSAGSSNGCSNNIGVCQQLCLPVPGG
LFSCACATGFQLNPDNRTCSPYSSFVVVSMLSAIKGFSLETSDHSEAMVPLAGRGRNALH
VDVHMPSGFIYWCDFSSTVSSQNAIRKIKPDGSYFRNVVTNGIGRNGIRGIAIDWVAGNL
YFTNAFLTETFIEVLRLNTTYRRVLLKTTIDMPRHIVVDPKTRYLFWADYGQNPKIERAF
LDCTNRTVLVSEGIVTPRGLAIDHSNGYVYWVDDSLDMIARIQPDGGDVEIVRYGSRYPT
PYGITIFGNSMIWVDRNLKKIFQASKQPGNADQPTVIRDNINWLRDVTIYNSNFQSRSPL
DVSNNPCLDNNGGCSHLCFALPDIQIPKCGCAFGTLGSDGKRCSISTDDYLIFALENALR
SIHLDPENHSPPFRTVNVLRTAVALDFDSINNRIYFTQSYPSGTGRISYVSIYSGIGSPT
VVASDLGTPDGIAFDWINNRVYYSDYLNQTISSMAVDGSNRTVIARVPRPRAVVLDPCRG
YMYWTDWSSNAKIERATLGGNFRTPIVSTNLVWPNGLTLDYEEEQLYWADANLQKIERCT
LTGTNREVIVSTALHPFAMTVFDQHIYWTDWNTRSIYRANKYDGSDQIVMIMNLPQRPMD
IHVWAKSKQQQCMNPCNQFNGGCSHICAPGPAGAECQCPSEGRWYLANNNKHCIVDNGTR
CDTGFFTCLNGHCISERWKCDNDNDCGDGSDELESVCAFHTCQPTAFTCGNGRCVPYHYR
CDHYNDCGDNSDELGCLFRTCDSNTEFTCNNGRCISLQYVCNGVNNCYDNGTSDERNCPE
RTCQSGFTKCQSTNICIPRTYLCDGDNDCGDMSDESPTHCVSLTCTNSEFRCTSGRCIPA
HWYCDQGIDCADGSDEPASCVPQMRTCSSDQFRCDDGRCIPATWICDGDNDCGDMSDEDQ
RHNCANRNCTAAEFTCANNRPPLRRCIPRAWVCDGDADCSDALDEHQNCTRRPCTESEFT
CNNGLCVRNAYRCDRRNDCGDSSDERGCIYEPCQQHQFTCQNGRCISKAYVCDGDNDCGD
ESDELEHLCSTPEATCSPHHFKCDNGNCIELVKVCNRLDDCLDNSDEKGCGVNECSDPSI
SGCDHDCTDTQTSFYCSCHPGYKLMSDKRTCDDIDECNETPSVCSQICENTAGSYICKCA
PGYIREPDGKSCRQNSNISPYLIFSNRYYLRNLTADGQSYSLILQGLRNVVALDFDRVEK
RLYWIDVGRNVVERMFLNGTNKEAVISDDVPNGEGIAVDWVGRKLYWVDAYRDCLYVSEL
DGRFRKKLVDRCVDANNTFCFQYPRAIVVHPKYGLIYWTDWADRAYIGRAGMDGKEKTVI
ISTKLEWPNGLTIDYTNDKLYWTDAHLNYIEYSDLDGHHRHTVYDGTLPHPFAITIFEDT
IYWTDWNTRTVEKGNKYDGSERTVLVNTTHRPFDIHVYHPYRQPFVNNPCGTNNGGCSHL
CLIKAGGQGFSCECPDNFMVIQLGNTAHCLPMCSSTQFLCADTERCIPIWWKCDGQRDCR
DGSDEPPTCPHRYCPVGQFQCNDGNCTSSHFLCNAQPDCHDRSDEDPVLCANHQCETHQW
QCANKRCIPEAWQCDREDDCGDNSDEDSAHCASRTCPPGQFKCDNGRCIPQSWKCDVDDD
CGDNSDEPFHECMGSAYRCDNHTQFSCRTNYRCVPLWAVCNGNDDCRDNSDEQGCEEMTC
SPFGDFRCDNHRCIPLRWKCDGDDDCGDNSDEHNCSPRECTESEYRCDNLRCIPSRWICD
HDDDCEDNSDERDCELRTCHPGYFQCDSGHCVAERFKCDGNADCLDFSDEATCPTRYPNG
TYCPPMLFECKNHVCIQPYWKCDGDNDCGDDSDEELHLCLDIACESPFRFRCENNRCIYS
HELCNQEDDCGDGSDEKEEHCREPTPRPCKTEEFKCSNGNCIPLHYVCDNYDDCGDHFDE
MGCNPGAERTCAENICEHNCTNLNEGGFICSCRPGYKASETNRNSCEDINECEIFGTCTQ
DCKNSKGSYECFCADGFRSVGDQQGKQCAADGNPPLLLLPDNVRIRRYNISSEQYSDYID
NQERIQALDYDWDPEGIGLSIVYFSILGQGSEFGAIKRAYLPTFDSSRNNPTKEVDLNLK
YIVNPDGLAVDWVGRHLYWTDAGTNRIEVAKLDGRYRKWLIFSHLDQPAAIAVNPKRGLM
YWTDWGRQPKIECAWMDGQQRQTLVSEDLGWPTGLSIDYLNNDRIYWSDSKENIIESMRP
DGTDRTIVLHGEVGSPYSLDVFEGHLYWIAKERGEVWRKDKFGSGEKVKVLTVNPWLTQV
RIYHQHRYNQSVPNPCKDVCSHLCLLRPGGYTCSCPQGTRFLEGSSTECDAAIESPPTMP
PACRCMNGGTCYIDESSLPKCKCSYGYTGNYCEIGLSKGVPPGTTAVAVLLTVILIIIIG
VLAIGGFFNYRRTGSLLPALPKLPSLSSLVKSNENGNGVTFRSGADVTMDIGVPGFGGDS
AIDRAMQMNENFAVESGKQPITFENPMYTTRDAGASTAGAVTVTRPTLVAAAGSEENENF
ENPVYSSVISTSPKETPQSTDAPLESKWSFFKRKKKQNTNFENPIYAEMEKEQQQDTENV
PTHSPSLPPKIILKRDQPLSYTATEDTFKDTANLVKEDSVV
NT seq 13986 nt   +upstreamnt  +downstreamnt
atggatggaagagcagcaactgcttgcaaactgctcatattattcactgcatgcataatg
cagggcagttgccaaggatgtgagcgggggcagttccgctgcggcaatggtcgctgtatt
cctgcagactggaggtgtgatggggccagagactgctcagatgatacagatgaagctggc
tgcccacaacctacctgtgagggaaatcagtttcagtgtcacactgatggggaatgtatt
ccacagtcatgggtttgtgatgatgaggaggattgtgaggatggctcagatgaacatcaa
caatgtccgggaaggacatgctcaagtcagcagttcacatgttccaatggacagtgcatc
ccgagtgcgtactggtgcgatcgagtggaggactgcactgatggaacagatgaaagagtc
tgccactacccaagatgtgaacagttatcatgtgcaaatggagcatgtttcaatgcaagc
cagcgatgtgatggtaaagttgattgcagagattcttccgatgaagctaattgcacacat
ggatgtaccagtacacagttccagtgtgctaatggagagtgcatcccacgagcctttatc
tgtgaccatgatgatgactgtggagataggagtgatgaaaactcttgcacttacgcaact
tgcagaggcaacttcttcacttgcccgagtggccgttgcattcatcagagctggatttgc
gatggagatgatgattgtgaagacaatgaagatgaaagaggatgtgaaagtggtcgccat
gaatgctacccaggagagtgggcctgccctggatcagggcattgcattccaatcgggaaa
gtgtgtgatggagctgcagactgccctgaaggagaagatgaaactaacatcactgcaggc
agacactgcaatgtatcacgctgcgctgcgctgagctgccagtatcgctgtcattcctct
ccatcaggagggatgtgctattgccctgcaggatatacaataagtaacaatgacagtcgt
acttgtactgattttgatgactgtcaaatgtggggtgtctgtgaccagctgtgtgaagat
cgtgtgggacatcaccagtgccactgtgtggaaggttatttcctagagcatcaccggcat
tgtcgggccaacacttcagctggtgttgcatcgatcattttttccaatggccgtgattta
ctgattggagacctttatggaagaaattttcgtactttggtgcagtcacagaatcgtggg
attgcagttggcgtggacttccacttttacctgcacaggatcttttggacagacacagtg
caagataaggttttttctattaatattgatggctctgatttccaagaagttttgaatatt
tcggttgacacacctgaaaatctagcagtggattgggttaacaataaactatatgtggtt
gagaccagtgtgaacagaatagatatggttaacttggatggaacaaaccgtgtgactctt
attgctgaaaatcttggaaatcctagaggaatagcacttgatccaactgttggttatttg
tttttctcagactgggacagtctgtctggtgatcctaaagtggaaagggctttcatggat
ggtacaaatcgtcaggacttgataaaaacaaaattaggctggcctgctggaataacgctg
gatattgtgtcaaagagactttactgggttgacagccggtttgattacattgagactgta
acttatgatggacttcaaaggagaacagtagctcatggaggctcactgattcctcatcca
tatggaattactttatttgaacacaatgtttatttcactgattggaccaaaatggcagtg
gtgaaagctaacaaattttcagagtctaaccctcaagtgatctaccagtcttcactgaga
ccttatggagtgacagtttaccacgctgccaggcagccatttgcaagaaatccttgtgga
agtaataatgggggatgtgaacaggtctgtgttctcagccacaaaacagataatgatggc
ctaggttatcgctgtaggtgtatcctgggctttgacctacatgtggatggacgacattgt
gttgctgtgcggcagttcctgctgttttcatcccagatggcagtgcggggaatcccattc
aatctctccacccaggaagatgtgatcatacctgtaacagggagcccttcatactttgtt
ggaattgacttctgtgctcaggatggcacaatttttttttcagacacaagtaaagatatg
atctataaacagaagactgatggttcaggaagagaaatcttgactgctaatagagtggaa
agtgttgaagatctggcttttgactggatctcaaagaacctctactggacagatcctcga
tacaggagcattagtgtgatgaggctggcagataaatccaggagagcaattgttcagaat
ttaaataatcctcgctcgatagtggttcatcctgttattgggtatatattctggacagat
tggttccgtccggcaaaaatcatgagggcctggagcgatggatcccatgccttgccgatt
gtaaatacaacactaggctggccgaatggccttgccattgactggagttctctgaggttg
tactgggtggatgctttttttgataaaattgagcacagcacctttgatgggttggacaga
cggactcttgaacatattactcagatgactcacccatttggccttactatttttggaggt
tatgcctatttcactgattggagacttggtggaatagttcgagtgaggaagtctgatgga
ggagaaatgactattattaggagagggattagtaacattatgcatgttaaagcatacgat
gctcattcccaaataggctctaactactgtaatagaggaacaaatcccaatggagactgc
agccatttctgcttcccagtaccaaactttcagagagtttgtgggtgtccttatggcatg
aagctggctccaaatcaactgacatgtgttgaagatccatccaatgagccacccactttg
cagtgtggctcttactcattttcctgtggtaatggaagatgtgtacctctatactatcag
tgtgatggtgttgatgattgccatgacaacagtgatgaacaaaactgtggttctttgaac
aatacttgtgcttcttcagcgtttacctgtgccagcggacagtgtattccgggtcgctgg
cattgtgataaacataatgactgttttgatggcagtgatgaattgcattgtcctacacaa
gaaccctcttcatgccctgcaacccagttcacctgtgataatagaagatgcattccaaga
atctggttatgtgatactgataatgactgtggtgatggctcagatgaaaaaaactgcact
ttcacaggtacttgtgaacccaggcaattccagtgtccagaccatcgctgtattgacccg
ttttatgtctgtgatggagacaaagactgtatagatggtgctgatgagcatgactgcata
tataactgcagtgccacagagtttaaatgtctaagtggagaccagtgtatcagtacctac
taccactgtgatggtgtttttgactgtaatgatcactcagatgaagctgattgccctaca
agaccaccaggaatgtgccaccagaatgaattccagtgtcagtcagatggcagttgtgtt
cctgataactgggaatgtgatggccatcttgactgtgcagatggctcagatgaacatcat
agatgtcctgctagaacgtgtcctccatcgcttttccgctgtgataatggcaactgtgtg
tacagagcatggatctgtgatggtgataacgactgcagggatatgagtgatgagagagat
tgtccaactcaacctttccggtgccccagctggcagtggcagtgtccaggtcacagtatc
tgtgtgaatctcagcaaagtatgtgataattctgctgattgtcctaatggagctgatgaa
tccccattgtgcaatgaaccccagccagatcaggaaagctgctctgacaataatgctggc
tgcactcatgaatgtattcaaggaccttttggagctcagtgtacctgtcctattggttac
cagcttgcaaatgactccaagacctgtgaagatattaatgaatgtgaccctccaggattt
tgtagtcagcactgttacaatgagagagggtcttttaggtgttattgtgatgaaggatac
attctagaagccaacgggaggacttgtaaagcagcagaatctgggaatcttcttttgctg
gtggcaagtcgtaaccaaatcgttgtggataacatcacttctcagtcacacagtatttat
tctctggttcgggatgggacaaatattgtggctattgattttgattccatcacagatcgt
atcttttggtcagatacaacacaggataaaatttggagtgcttataaaaatgggactgac
agaaaaatagtgtttgacagtggtgtcactgtgactgaaagtatagcggtagattgggtg
ggtcgtaacctttactggacagactttgttctggaaactattgaagtctccaacatggat
gggagccacaggactgtgctgattagtgaaaatataacaaacccaagaggactagtgtta
gatcccagaactgatgctcatgtaatgttctggacggactggggccaaaaccctcgaatt
gaaaaagccagcatggatggcaaaatgcgctcagtgattattaataataaaatctactgg
cccaatggactttccattgattatccaaataaacttctctattttgctgatgcttatctt
gattatatcgatttctgtgattacaatggaaacaatagacgacaggtggttgcaagtgat
ctgatattgcagcatccacatgggctaactgtctttgaagattttgtgtactggagtgac
cgctatactaatcgagtaattcgggccaataaatggcatggaggaaaccagacagttatg
atttataacattcaccagcctttgggtcttgtggcagtccatcctgtaaagcagcctaat
ggtattaattcctgtgcatcatccccctgtagccacctctgcttactttcttcatctgga
ccactttttttttcctgtgcttgcccttcaggatggctcctttctcctgataacaggaac
tgcatgagagttgaacaccctttccttattgctgtaagagagaatataatttacggaatt
tctctgaaccctgaggagaagacaaatgatgctatggttccaatagcaggagttcaaaat
ggtgtcgatgttgactttgatgactctgaacagatgatttattgggttgaaaatccaggt
gaaatacacagagtgaggtcagatggagccaacaggacagtttttgctccagcagctgtt
attggtgctcctcttggtctggcactagactggatatctgcaaacctgtattacagtaac
ccagggacacagtcaattgaggtcctgaagctgcatggtgacataatgtacaggaaaaca
ctgattaccaatgatggcacctctctgggagctggcacgcctattggtttggcagttgat
ccagcaagagggaagttgtactggacagaccagggaactgacagtggagtcccagcaaag
attgccagttcaaacatggatggctcaagcatacaaaccctcttcacaggcagcctggac
catgtagagttccttaccattgacattaaggaacaaaagttgtactgggctgtcacgagc
acaggaatgattgagagaggcaatgtggatggtacaaatcgtgtgactctggtggttcat
ctttctcatccctggggagttgctgtgtatggtacatttctgtactatactgatcgagat
tatgaagtaattgaacgagttgacaaggccactggtgcaaacaaagtagtactgagagat
aatgtcccaagactgaagagcctacgtgtgtattacagagacaattctgctggttcctca
aatggctgcagtaataatattggagtttgccagcagctttgcctgcctgtacctggtgga
ctattctcctgtgcctgtgctactggctttcagctaaatcctgataacagaacctgttcc
ccatacagttcatttgtagttgtttctatgctctctgcaattaaaggatttagtttagag
acatcagatcactctgaagccatggtaccactggcaggaagaggacgaaatgcacttcat
gtggatgttcacatgccttctggtttcatttactggtgtgacttcagtagcacagtttct
tctcaaaatgcaatacgtaaaattaaacctgatggttcttattttagaaatgttgttaca
aatggaataggacgaaatgggatccgtggcattgcaattgactgggtagcaggaaatctt
tattttacaaatgcattcctgacagagacttttatagaagttttgcgtttaaacacaact
tatcgccgtgtacttctgaaaactaccatagacatgccaaggcacatagtagttgaccca
aaaaccagatatctcttctgggcagattatgggcaaaatccaaagattgaacgtgcattt
cttgactgcaccaacagaacagttcttgtgtctgagggcattgtcacgcctcgtgggttg
gccatagatcacagcaatggctacgtttactgggttgatgattccctagatatgattgca
agaattcagcctgatggtggtgatgttgaaattgtgcgttatggcagtcgctatccaact
ccatatggtatcactatctttggcaattccatgatctgggttgatcgaaacctgaaaaaa
atcttccaagccagcaaacagccaggcaatgctgatcagccaacagtaataagagataac
attaattggctaagggatgttacaatttacaacagtaatttccagtcacgttcacccctt
gatgtcagcaacaatccttgtttggacaacaatggaggttgttctcacctctgttttgcc
cttcctgacattcagataccaaaatgtggttgtgcctttggaacactaggcagtgatggc
aagagatgttccatttcaacagatgattacctgatttttgctcttgaaaatgccctcaga
agtatccacctagatcctgaaaaccacagtcctcccttccgcacagtcaatgtgttaaga
actgctgtggccctggattttgacagcataaacaaccgaatatattttacacaaagttat
ccttcaggaacaggaagaatcagttatgttagtatttactcaggaattggctctccaact
gtagttgcatctgacctggggactccagatggcatagcctttgactggatcaacaacaga
gtttactacagtgactacctcaaccagaccatcagctcaatggctgtggatggatcaaac
cgcacagtgattgcccgggtgccacggccaagagctgttgtattagatccctgcagaggg
tatatgtactggactgattggagttcaaatgcaaagattgaacgagctacacttggagga
aattttagaacacctattgtgagcacaaacttggtatggccaaatggacttaccctggac
tatgaagaagagcagctgtactgggctgatgcaaatctgcagaagattgagagatgcact
ctcactggtacaaatcgtgaggtaattgttagcactgcgctgcatccatttgcaatgaca
gtgtttgatcagcacatatattggacagactggaacacacgaagcatttatagagctaat
aagtatgatggctcagatcagattgtgatgatcatgaatcttccacaaagaccaatggat
attcatgtttgggcaaaaagtaagcagcagcagtgtatgaacccttgcaaccagttcaat
ggtggctgcagtcacatctgtgcaccaggtccagctggtgcagaatgtcagtgcccctct
gaaggtcgctggtatttagccaataacaataagcattgtatcgtggataatggtaccagg
tgtgataccggtttcttcacatgccttaatggacactgtatctctgagcggtggaaatgt
gacaacgacaatgattgtggagatggcagtgatgagttggaaagtgtgtgtgctttccat
acttgtcagccaacagctttcacctgtggcaatgggcgatgcgtaccctatcattaccgc
tgcgatcactacaatgactgtggagataacagtgatgagcttggctgcttgtttcgaacc
tgtgactccaacacagaatttacttgcaataatggaaggtgtatatcccttcagtatgtc
tgcaatggagtaaacaactgttatgacaatggcacatcagatgagaggaattgtccggag
cgtacgtgccagtctggttttacaaaatgtcaaagcacaaatatttgcattcctcgaaca
tatttgtgtgatggtgataatgattgcggagatatgagtgatgagagtcctactcactgt
gtctctctgacttgcacaaatagtgagtttcgttgtacatcgggacgttgtattcctgct
cattggtactgtgatcaaggaatagactgtgctgatggctctgatgaacctgcctcttgt
gtgcctcaaatgcggacttgttcgagtgaccagttcagatgtgatgatggcagatgtatc
ccagcaacgtggatctgtgatggtgataatgactgtggggatatgagtgatgaggatcaa
agacataattgtgcaaaccgcaactgcacagcagcagagttcacttgtgccaacaatcga
cccccgctcaggaggtgcattcctcgggcatgggtctgtgatggtgatgctgactgcagt
gatgctcttgatgaacaccagaactgcacacgaagaccttgcacagaaagtgaatttacc
tgtaataatggcttgtgcgtccgtaatgcatacaggtgtgataggcggaatgactgtggt
gacagcagtgatgaaagaggatgcatctatgaaccatgtcaacagcaccagtttacttgt
cagaatggacgctgcatttccaaagcctatgtctgtgatggggataatgactgtggtgat
gaatctgatgagctggaacatctctgtagtacaccagaagcgacctgctctccccatcat
tttaaatgtgacaatggaaactgcattgagctggttaaagtctgcaatcggttggatgat
tgcttagataacagtgatgaaaaaggatgtggtgtaaatgaatgcagtgatccttcaatc
agcggatgtgatcatgactgtacagacacacagacaagtttctactgttcttgtcatcct
ggatacaaacttatgtctgataaacggacttgtgatgatattgatgagtgcaatgaaact
ccatcagtatgtagccagatttgtgagaacacagctggctcctacatctgtaagtgtgcc
ccaggctatatccgggagcctgacggaaaaagttgccggcaaaatagtaatatctcccca
taccttatttttagcaaccgttactatctgagaaatctcacagcagatggccagtcttac
tctctcattttgcaaggactgagaaatgtggtggcactggactttgacagggtggaaaag
aggttatactggattgatgtggggaggaatgtcgttgaacgaatgttcctaaatggaaca
aataaggaggcagtgataagtgatgatgtgcccaacggggaaggtatcgctgttgactgg
gttggcagaaaattgtactgggtagatgcctaccgagattgtctctatgtctctgaactt
gatggaagattccggaaaaaactggtggatcggtgtgtggatgccaacaatactttctgc
tttcagtatcccagagcaattgtggttcatccaaaatatggactgatttactggacagac
tgggcagatcgagcctatattggacgagctggcatggatggcaaggagaagactgtgatc
atctctacaaagttagagtggcccaatggacttaccatagattacaccaacgacaagctt
tattggacagatgcccatctaaattatattgagtactctgacctggatggacatcatcgg
cacacggtatacgatgggactctaccccatccatttgcaataactatttttgaagacacg
atatattggactgactggaacacaaggacagttgaaaaaggaaataaatatgatggatca
gaaaggactgttcttgttaataccacacacagaccatttgacatccatgtttaccatcca
tacagacaaccatttgttaacaatccttgtggcaccaataatggtggttgttcccatctt
tgcctaataaaagctggtggccaggggttttcctgtgaatgtcctgataacttcatggta
atacagcttggcaatacagcccactgccttccaatgtgctctagtacccagtttctctgt
gcagacactgagaggtgtattcccatctggtggaaatgtgacggacagagggactgtcga
gatggctctgatgagcccccaacctgtccacaccggtactgtcctgtggggcagttccag
tgtaatgatgggaactgcacaagttcacatttcttgtgcaatgcccagccggattgccat
gacagatcagatgaagatcctgtactttgtgctaatcaccagtgtgaaactcatcagtgg
caatgtgccaacaagcgatgtatcccggaagcctggcagtgtgatagagaggatgactgt
ggtgacaactcggatgaagatagtgctcactgtgccagtagaacctgtcccccaggccaa
tttaaatgtgacaatggccgttgcatcccacagtcctggaagtgtgatgtggatgatgat
tgtggtgataactctgatgagccattccacgaatgcatgggatctgcttatcgatgtgac
aatcacacacaattcagctgtagaaccaactaccgttgtgtaccattgtgggcagtgtgc
aatgggaacgatgactgtagagacaacagtgatgaacaaggctgtgaggagatgacttgc
agtccttttggagatttccgttgcgacaatcatcgatgtatcccgctgcgctggaagtgt
gacggagatgatgactgcggagataactctgatgagcacaactgcagtcctcgtgagtgc
acagaaagtgaataccgttgtgacaatctgcgctgcattccttcccggtggatctgtgac
catgatgatgactgtgaagacaattcggatgaacgtgactgtgagctgagaacctgccac
ccaggttatttccagtgtgacagtggacactgtgtcgcagagcgcttcaaatgtgatgga
aatgcagactgccttgatttctctgatgaagcaacttgtccaacacggtatcctaatggt
acatactgtccacccatgctgtttgaatgcaaaaaccatgtctgtattcagccatactgg
aaatgtgatggggataatgattgtggagatgactctgatgaagaacttcacctttgcttg
gatattgcttgtgaatctccattccgtttccggtgtgaaaacaatcgctgtatatacagt
catgagctgtgcaaccaggaggatgactgtggagatggcagtgacgagaaagaggaacac
tgtagagagccaacaccaagaccttgtaaaactgaagaattcaagtgcagtaatggaaat
tgcattcccctacattatgtctgtgacaattacgatgactgtggagaccattttgatgaa
atgggctgcaatcctggagcagagcgaacttgtgcagaaaatatctgtgaacataactgt
accaatctgaatgaaggaggctttatctgttcctgcaggccagggtacaaggccagtgaa
actaaccgtaactcctgtgaagatattaatgagtgtgagatctttggaacgtgcacccaa
gactgcaagaattccaaaggaagctatgaatgtttctgtgcagatggcttcagatctgtg
ggtgatcaacaagggaaacagtgtgcagctgatggtaatcctccattgttactgctgcca
gataatgtgcggattcgaaggtacaacatctcatcagaacagtactctgactatattgat
aaccaggaacgcatccaagctctggattatgactgggaccctgaagggataggcctgagt
attgtgtacttcagcattctgggacagggttctgagtttggagccatcaaacgtgcttat
ctccccacttttgacagcagtaggaacaatccaacaaaggaagttgacttgaatctcaaa
tacatagttaatcctgatgggctagctgttgactgggttggaagacatctttactggact
gatgcagggactaatcgcatagaggtggcaaaattagatggacggtatagaaaatggctt
attttttcccatctggatcaaccagcagctattgctgtcaatccaaaacgtgggcttatg
tattggactgactggggaaggcagccaaagattgaatgtgcctggatggatggacaacaa
agacagacactggtctctgaagaccttggctggccaactggtctttctattgattatttg
aacaatgataggatctattggagtgattctaaagaaaatataattgaatccatgagacct
gatgggacagacagaaccattgtactacatggagaagtaggcagtccatacagcctcgat
gtctttgaaggccatttatattggatagctaaagaacggggagaagtctggaggaaggat
aagtttggaagtggagaaaaagtgaaagtgctgactgtaaatccgtggcttacccaagtg
cgcatctatcaccaacacagatacaatcaatcagtgcctaatccttgtaaagatgtctgc
agccacctctgcttgctgagaccaggaggatacacctgctcatgtccccaagggactcgg
ttcctagaaggcagcagcacggaatgtgatgcagctattgaatcccctcccacaatgcca
ccagcttgcaggtgcatgaacggtggaacatgctatatagatgaaagcagtcttcccaaa
tgcaaatgttcttatggatacactgggaattattgtgaaataggattgtcaaaaggagtc
cctcctggaacaacagcagtagcagtgttgctgacagtcatactaatcataataattgga
gtgttagcaattggaggcttttttaactacagacgaacaggctcccttttaccagcgctt
cccaaactaccaagtttaagcagtcttgtaaaatctaatgaaaatggcaatggagttact
ttccgatctggagcagatgtgactatggacataggtgtccctggctttgggggagattct
gctatagacagggcaatgcaaatgaatgaaaactttgcagtggagtcggggaaacaacca
atcacgtttgaaaatccaatgtatacaaccagagatgctggagccagcacagctggtgca
gttacagttactcgaccaacacttgtagcagcagctggtagtgaggaaaatgaaaatttt
gaaaatcctgtgtattcctctgtgatatctactagcccaaaggaaacccctcagagtaca
gatgcacctctggaatcaaagtggagtttcttcaagagaaaaaagaaacaaaacactaat
tttgaaaacccaatatatgcggagatggaaaaggagcagcaacaggacacagaaaatgtc
cctacccattctccttcactgcctcccaagattattctgaagagagaccaaccactatct
tacacagcaacagaggatacatttaaagacaccgccaatcttgttaaagaggactctgtg
gtataa

DBGET integrated database retrieval system