KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104382Help
Entry
102104382         CDS       T02921                                 

Gene name
BMI1, COMMD3
Definition
(RefSeq) uncharacterized LOC102104382
  KO
K11459  polycomb group RING finger protein 4
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102104382 (BMI1)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     102104382 (BMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL COMM_domain zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-rbx1 zf-RING_5 Prok-RING_4 zf-RING_UBOX zf-Nse zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 102104382
NCBI-ProteinID: XP_005518799
LinkDB All DBs
Position
Un
AA seq 848 aa AA seqDB search
MELSPYAQGGWRLLGDPRRFPRRPFAALLRAAFRSLLDHPQAGLDDPDLKDIDPTVLKHC
HAAAATCILEAGKQKADISAISTCLEDCKLDKERIEQFCTEYQKNKDALEILLGSIGRSP
LHITDVSWRLEYQIKNNQLHKTYQPSYLVTLNVENSDSGSHPDVSFSCTMEQLQDLVGKL
KDAAKSLERLDPGAGEQERIRFNLADPGRLTKSRQVPRSGAGWRLRLDGAAAASISRSPR
AAPGSAVLRGAARSAGRCGGAPSRGPSAPAGEGERPRGGCAAAAGLSPRSRAFSSPLLRA
PAAGGVLSSPEASTARVSPVLSLPLRRPSVPPAGCGDTAGPRATGSCRRSGRKSFRAALE
GTRRLDAGGPGRARRGEGRAAARTRWRRREAAEPPGGPYAAGRGGRGGERATRTRERPRG
GAGGRGRDNGLVERGLIRTGETVRSQRLSRPGGQLGGSERARERARRAREERRRPGRSFI
SRWPLGSHSFSAERLLTFIVFFGRSDHHPPAPFSGAAPRHAKMHRTTRIKITELNPHLMC
VLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDI
VYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFF
DQNRLERKGNKEKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEE
PLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQREGLNNSGELESDSGSDKA
SSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSSSPSSNHQSSFTNRARKTSIN
GSSATSSG
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcgccgtacgcgcagggcgggtggcggctgctgggcgacccccgccgcttc
ccccgccgccccttcgccgccctcctccgcgccgccttccgcagcctcctggatcacccg
caggccgggttggacgatccagacctgaaagatattgaccctacggtattaaagcattgc
catgctgcggctgcaacgtgtattctggaggcagggaagcagaaagctgacatatctgct
ataagcacatgcctggaagactgcaaactggataaagagagaatagaacaattttgcacc
gaatatcagaaaaacaaggatgcattggaaatcctattgggaagcataggcagatctcct
ctgcatataactgatgtgtcttggcgcttggaatatcagatcaagaacaatcaacttcat
aaaacttatcagccttcctatttggtgaccttaaacgtagagaacagtgattcaggatca
cacccagatgttagttttagttgtacgatggagcaattacaggatttagtgggaaagcta
aaagatgctgcaaaaagtctagaacgattggaccccggcgcgggggagcaagaaaggatt
cggtttaatcttgcggacccggggcgcctcacgaaaagccggcaggttccacggagcgga
gccgggtggcggctccggctcgacggcgcggctgctgctagcatctcccgctcgcctcgg
gccgcgcccggctccgccgttctccgtggggccgctcgctccgccggcaggtgcggaggg
gctccgagtcgcggtccatccgcacctgccggcgagggagagcggccccgcggaggatgc
gcggcggcggccggtctctcgccgcggagcagggctttttcctctccgctcctccgcgcc
ccagcggcgggcggcgtcttatcctcgccggaggcgagcaccgcgagggtttccccggtt
ctctccctcccgctccggcggccgtccgtcccgcccgcggggtgtggggacaccgcgggt
ccccgcgccaccggctcctgccgccgctcggggcggaaaagcttccgcgcggccctcgag
gggacgcgtcgcctcgacgccggcggccccgggcgggcgcggcggggcgaggggcgcgcg
gcagcgcgcacgcggtggcggaggcgcgaggccgcggagccccccgggggtccctacgcg
gcgggacggggcggccggggaggggagcgcgcaacaagaacgcgagagaggccgcgaggc
ggagcggggggcagagggagagacaatgggctggtggagagaggactcatccggaccggg
gagactgtgcgctcccagcgcctgagccgcccgggcggccaactcggagggagcgagaga
gcgagggagcgagcgagaagggcccgcgaggagcggaggagacccgggcgttctttcatt
tcaagatggccgcttggctcacattcattttctgctgaacgacttttaactttcattgtc
ttttttggccgctccgatcatcacccaccggctccgttttccggagccgctcctcgccac
gccaaaatgcaccgaacaaccagaatcaaaataaccgagctaaacccccatctcatgtgc
gtgctctgcggtgggtacttcattgatgcaacgaccatcatagagtgcctccactccttc
tgtaagacctgtatcgtgcgttacttggagaccagcaagtattgtcctatctgtgatgtc
caagttcacaaaactcgaccgcttttgaatataaggtcagataaaactctccaagatatt
gtatacaagctagtaccaggccttttcaaaaatgaaatgaaaagaagaagggatttttat
gctgctcatccgtcggctgatgctgccaatggctctaatgaagacaggggagaagtggct
gatgaagacaaaagaattataacagacgacgagataataagcttatccattgaattcttt
gaccagaatagactggagcgaaaaggaaataaggagaaagaaaaatcaaaagaagaggtg
aatgacaaaagatacttgcgctgcccagcagcaatgacagtgatgcatctaagaaagttc
ttgcggagtaagatggatatacctaacactttccagatcgatgtgatgtatgaagaggag
cctctgaaggactactacaccctaatggatattgcctacatctacacctggaggcggaat
gggcctctgcccttgaaataccgcgtccgacctacttgcaagaggatgaagatcagtcac
cagagggaagggttgaacaacagtggggagctggaaagtgactctgggagcgacaaggcg
agcagcccagcaggaggcatcccctccacctcctcctgtttgcccagccccagcacacca
gtccagtctcctcacccccagttcccccacatctccagcaccatgaatggcaccagcagc
agccccagcagtaaccaccagtcctcctttaccaacagagctcggaaaacatcaataaat
ggctcctcagccacttcatctggttga

DBGET integrated database retrieval system