KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104772
Entry
102104772         CDS       T02921                                 

Gene name
CUL3
Definition
(RefSeq) cullin 3
  KO
K03869  cullin 3
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04120  Ubiquitin mediated proteolysis
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102104772 (CUL3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102104772 (CUL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102104772 (CUL3)
   03400 DNA repair and recombination proteins [BR:phi03400]
    102104772 (CUL3)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     102104772 (CUL3)
DNA repair and recombination proteins [BR:phi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     102104772 (CUL3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 102104772
NCBI-ProteinID: XP_005527091
LinkDB
Position
Un
AA seq 768 aa
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESF
NNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYL
AKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtcgaacctgagcaaggggacgggcagccggaaggacaccaagatgcggatccgcgcc
ttccccatgactatggatgagaaatatgtgaacagcatttgggatcttctgaaaaacgca
atccaagagattcagcgtaagaacaatagtggtctcagttttgaggagctgtatagaaat
gcttatacaatggtgttgcataaacatggtgaaaaactctacactggactaagagaagtg
gtcactgaacatctaataaacaaggtgcgagaagacgtgttaaattccttgaataacaac
tttctacaaacactaaaccaagcatggaatgatcatcaaacagcaatggtgatgattaga
gacattctgatgtatatggaccgagtgtatgtgcaacaaaacaatgtggagaatgtctac
aacttgggcctgataatttttcgagatcaagtcgtacgttatggatgcatcagggatcac
ctgaggcaaaccctgctggatatgattgcaagagagaggaaaggagaagttgtagacaga
ggcgcaataagaaatgcttgccagatgttaatgattctaggtcttgaaggaaggtcagtc
tatgaagaagacttcgaggctccatttttggaaatgtctgcagaattttttcagatggaa
agtcagaaatttttagctgaaaacagtgcttctgtgtatataaagaaagtagaagctaga
attaatgaagaaatagagcgggtgatgcattgtctggataaatcaacagaagaacccatt
gtgaaagttgttgagagggagcttatttccaagcatatgaaaactatagtggaaatggag
aactctgggttagttcatatgctgaaaaatgggaagacagaagaccttgcttgcatgtac
aagttgttcagccgtgtgccaaatggtctgaagacgatgtgtgagtgcatgagctcatac
ttgagagagcaaggcaaagcactggtttctgaagagggagaaggaaagaatccagttgac
tacattcagggtttactggacttgaagagtaggtttgaccgcttccttcaagaatctttc
aataacgatcggctcttcaagcagacgattgcgggtgactttgagtacttcctcaacctc
aactccaggtctccagagtacctctcattatttattgacgataagctgaaaaagggagtc
aagggactaacagagcaagaagtagaaactatattggataaggcaatggttttattcagg
tttatgcaagagaaagatgtttttgaacgctattacaagcagcacttggcaagaagactt
ctcacaaataagagtgtttcagatgactctgagaaaaatatgatctccaaattaaagact
gaatgtggatgtcagttcacatcgaaactggaaggaatgttcagggacatgagcatctca
aacacaacgatggatgagttcaggcaacatcttcaggcgacaggggtctcactaggaggt
gttgatctcacagtgcgtgtcctcacaacaggttactggcctacccagtcagccacacca
aagtgcaacatccctccagctcccagacatgcttttgaaatatttagaagattttattta
gccaaacacagtgggcgacagctgacactccagcatcacatgggttctgcagatctcaat
gccactttctatgggcctgttaaaaaggaagatggctcagaagttggtgtaggaggtgcc
caagtaactggctcaaatacacggaagcacatattgcaagtctccactttccagatgaca
atattaatgctatttaacaacagagaaaaatacacatttgaggaaattcaacaagaaact
gatatccccgaaagagaactggttagagccctacagtcccttgcatgtggcaaaccaaca
caacgtgttctcacaaaagagcccaaatcaaaagaaatagaaaatggtcatatatttaca
gtgaatgatcagttcacatctaaactacacagagtcaagattcagacggttgctgccaaa
caaggagaatctgatccagaaaggaaagaaacaaggcagaaagtagatgatgacagaaaa
catgagatagaagctgctatagttcggataatgaaatctagaaagaagatgcaacacaat
gtgctagtagcagaggtaactcagcagctgaaggcccgattcttaccaagtccagttgtt
attaaaaaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggat
cgcaaagtatacacttacgtagcataa

DBGET integrated database retrieval system