KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104990
Entry
102104990         CDS       T02921                                 

Gene name
EVC2
Definition
(RefSeq) EvC ciliary complex subunit 2
  KO
K19608  ellis van creveld syndrome protein 2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102104990 (EVC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102104990 (EVC2)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    102104990 (EVC2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 102104990
NCBI-ProteinID: XP_005517905
LinkDB
Position
Un
AA seq 1262 aa
MDTFLLPPSDQIFLHPQTCLXKWKKVFEDGLWLQKEMGCLGMAEMPFPVVTEAGKTTQQL
LTSAASDSQWSHSVFALIPSWTKKVLFKRESDLSPLLPEDVSNMSVSSEFGITLQKCGMV
DVEHDPQTAYIKLVINNTNTLLSTNITDLILLDNITGLHIQKTSGNKTTDGIQIYRKSFL
QGGEHFEINYSALLDAEEMWHGRVLTLPAKLTFKSSSQNKTHFVSLTASFTITEEEKTKI
LYGHAISASGFFIAFFVSLVLTCAVFFIVYRTQILKWSFCSKNQEIQPDLSQNHKLERSQ
FNSGDLFSEDIIMNDQIIDILSFEEPGNMLQALEDLEVASLTRADADLEANRTQICKEVI
AMMLKNMVLNHSLFPHVEKKISSVFKKQFLAMEKEIQEEYERKMVALTAECNLETRKTME
AQCQKARAANEEAEELMKKINEKPAIEYRSLLDKLHRLEQDCLKRFLFVKQEEYFAKAYR
ELAVIQRKELHTIFYTQIRNATLKGELKLEAAKTLVEGYSKIQGDIEELMDFLQACKKYH
LNKRFSYREYLISKIQSRDSRVSALINATAAQISSLINKTERAGHLPESDLGILLDRAET
EINFIKQKFDHDLKEEKQKLCQKLITKRRREMLLQKKEHQKEQLSLGDPFKTTTEISHYL
RHWKNLLSDHTIEFEDLTEKLDSEASEELKELLFSVAEKAIEELKRVHCGVFVQEMVKLN
VPKLFLLEAVEEHKKEMVVKHAQLEREEHDKSMAAEELLQLTRQKLSQELETGISEQKTI
RSWEQSIFMQLLSLPLSLSEEELLRMRQELHCCFSQVDSSLAWPKIRARTLLQAFEVEKR
DTKVLKVEQDLAMTKKQQHSKMGKKGSRNRNKLDILKKSLQDKILIYEDSVKRENLNRIK
YELQLEKECHLHNLENKLGEYIASLAFQKTVKKSKMLELYTAIINVQALLFKQLNTSKTL
SKLECIQILEAHNPEIEELNRKLEYEMMHKESAQQHLMSRQRWFLDGLGLSNEAVDTNAE
RHVTVLLRQAMNKCKQFINLYQQGLRDEQWNCVVFEDLLENIETNAFSAIYSQELRLAGY
LAKLTRVPMGVLHRVLNLLLPSSSQSEVLSVLDSISEYSDGGVEGDSNADESGSCKKRKS
QELWQALETKIRQDLINRSLENIPSLNKRKDSLIKKKQLALLEKAAFIHLGCSPAHPPPE
QPDPPVSLNSATAEAIELLDTGEKIFLFREPSDPILALHNFPRKKKKNFLNSKKAAHANM
GS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atggacacattcctgctgcctcctagtgatcagattttcctgcatcctcaaacatgccta
tgaaaatggaaaaaagtttttgaagatggtctgtggcttcagaaagagatgggatgccta
ggaatggcagaaatgccctttcctgtggtcactgaggcaggcaaaaccactcagcagctt
ttgacctctgcagcctcagacagccagtggagccattcagtgtttgccttgataccctca
tggacaaagaaggtgttgttcaaacgagagtctgacctcagcccccttctgcctgaagat
gtgtccaatatgtcagtgtcttctgaatttggaataacccttcagaaatgtggtatggtg
gatgttgaacatgaccctcaaactgcatacattaaacttgtgattaataacaccaacaca
ttgctctcaacaaacatcacagatcttatcctcctggacaacatcactggtctacacatt
caaaaaaccagtgggaataagaccacagatggcatacagatttacaggaaaagtttcttg
caaggtggagaacactttgaaatcaactactctgcacttcttgatgcagaagaaatgtgg
catggcagggtcttgacactgcctgcgaagctaactttcaagagttcatcacagaataaa
acacattttgtatcattgacagcgtcatttaccataacagaagaagaaaagaccaagatt
ttatatggccatgccatcagtgcttcagggttcttcattgctttttttgtttcccttgta
ttgacatgtgctgtctttttcatcgtttaccgaacccaaatattaaaatggagtttctgt
agtaaaaaccaggagatacagcctgatctcagccaaaatcacaaactggagcgttctcaa
tttaattcaggtgatctctttagtgaagatataattatgaatgaccaaatcattgatatt
ctgtcctttgaagaacctgggaacatgcttcaggctttagaagatttggaggttgccagc
ctgacacgggcagatgctgatctggaagccaatcgaacacagatctgtaaagaagtgatt
gctatgatgttgaagaacatggtcttaaatcacagcctctttcctcatgtggagaagaag
ataagttcagttttcaaaaagcaatttcttgcaatggagaaagaaattcaagaagagtat
gaaaggaagatggtggctttaacagctgaatgtaatctggaaactaggaagacaatggag
gctcaatgtcaaaaagcaagagctgcaaatgaagaggctgaggaattaatgaagaaaatt
aatgaaaagcctgctatagaatacagaagtcttctggacaaacttcacagactggaacag
gactgcctgaagaggttccttttcgtgaagcaggaggaatattttgcaaaggcttataga
gagctggctgttatccaaagaaaggagctccatactatcttttatacacagataagaaat
gccacattaaagggagaactgaagttggaagcagctaaaacattagtggaaggttactct
aaaatacagggtgacattgaagagttaatggactttttgcaagcttgcaagaagtatcat
ctgaataaaagattttcttacagagaatatcttataagtaagatacagtcaagggattct
cgtgtctctgctcttataaatgccacagcagcccagatatcaagtctcattaataagaca
gaaagagcaggtcatctacctgaaagtgatttgggaatcctgttggacagagctgagact
gaaattaattttattaagcagaaatttgatcatgatttaaaagaagaaaagcagaagctt
tgccagaaactcattaccaagcgaaggcgagaaatgctgctgcaaaagaaagagcatcag
aaggagcagctgtcacttggagaccccttcaaaactactactgagatctctcactacctg
agacactggaagaatcttctgagtgatcacaccattgaatttgaggatcttactgaaaag
cttgacagtgaagccagtgaagagctgaaggagcttctatttagcgtagcagagaaagcc
attgaagagcttaaacgtgttcactgtggagtgtttgtacaagaaatggtcaagctcaat
gtgccaaagttgttcctgctagaagctgtggaggagcacaaaaaagagatggtggttaag
catgcacagcttgaaagggaggaacatgacaagagcatggctgctgaagagctgcttcag
ctcaccaggcaaaagctaagccaagagctggaaacgggcatctcagaacaaaaaacaata
aggagctgggaacagtcaatattcatgcaacttctaagtttacccctctcactttcagaa
gaggagttgcttagaatgaggcaagagttgcactgctgcttctctcaggtggacagcagc
ttggcttggcccaagataagagcaagaaccttgcttcaggcttttgaagtggagaagagg
gacaccaaggtgctgaaagttgagcaggatttagcaatgaccaaaaaacagcagcattct
aaaatgggaaaaaaaggatccaggaatagaaataaattagatattctgaagaaatcttta
caggacaaaattttaatttacgaagactcagtgaaacgtgaaaatttgaataggattaag
tatgagttgcagcttgaaaaagagtgtcacctgcacaatctggaaaataaacttggagag
tatattgcttctttagcctttcaaaagactgttaaaaaatctaaaatgctggagctgtat
acggctatcataaatgtgcaagcattgctctttaaacaactgaacacatcaaaaaccctg
tcaaaactggaatgtattcagattttagaagcacataatcctgagattgaagaacttaac
aggaaattggagtatgagatgatgcataaggagtcagcacagcagcatctaatgagtagg
cagaggtggtttctggatggtttgggactctcaaatgaagctgtggacacgaatgcagaa
agacatgtgacagttctgttaagacaggccatgaataaatgtaaacaatttataaacctg
taccagcaaggcttgagagatgagcaatggaattgcgtggtgtttgaagatctcctggaa
aatatagaaacgaatgcattttcggcaatttatagtcaggagctccgtctggcaggttat
ttagctaaactgacaagggtgccaatgggggtattgcacagggtcctgaacttgttgctg
ccctccagctcgcaaagtgaggttctttctgtcctcgattccatcagtgaatactcagat
ggtggtgttgaaggtgacagtaatgcagatgagtctggcagctgtaagaaaaggaagagc
caagagttgtggcaagcactggagaccaaaataaggcaagatctgataaacagaagttta
gaaaatatcccttctctaaacaagagaaaagacagcttgataaagaagaagcaacttgct
ctcttggagaaagcagcattcattcatctgggatgttcacctgcacatcctcctccagaa
cagcctgatccacctgtttctctgaactctgcaactgctgaagccatagagctgttagac
acaggggagaagatatttttgttccgtgagccaagtgatccaatacttgctttgcataat
tttccaagaaaaaagaaaaagaactttcttaattctaaaaaggctgctcatgcaaacatg
ggctcataa

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110311
Entry
102110311         CDS       T02921                                 

Gene name
EVC
Definition
(RefSeq) EvC ciliary complex subunit 1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102110311 (EVC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102110311 (EVC)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    102110311 (EVC)
SSDB
Motif
Pfam: DUF4046
Other DBs
NCBI-GeneID: 102110311
NCBI-ProteinID: XP_005518105
LinkDB
Position
Un
AA seq 986 aa
MAAVGDCLRAVGLQFWADSVQALPALLAPAVLLGLLLGAAAAALLCRCALGPRRGGEKDY
SQRLLESFNPGEKEHTVVKSEAEPYTSKEEMVLEESESPLNSNITAFALKAKVIYPINQK
FRPLADGSSNPSLHENPKQAVLPNQVVETSMSGSLGSLSQGDKGDCSSSTTIHSTTSDDR
FQARAFLKVASFPEVLTCESFDVKLCLCSLILKDLMLLDTELRKEKHVMFIQIFKIYLTD
FHRKKKITDGLLKKILLNQENNFGELQKQLDSRLQNTEMSGGHNLEFQTLEDIERKEREY
SEHVIDNMEAFWKQTDKAQQDFLDQSKCSSAKAAKIMMDLTEKMIAVESLLSESQDLQAM
DIQERLFNWELMVKMIDSLKSSIPEECKGRLNTVSNILDHLTVKNNLSVRQKEELLTDLH
KAFWEQLAHYSNECIQQSKDLILKRLERRAEKKEEFRRRQEAEQESLLNKTFLTEDVHNF
LKAYHELMEKHWQAQWDLEEEDDCESAEAVTDLYKELYSKASHALAELVTELFLQTLPVV
TSLSVRECELLKEEWQENLVPELEKWENHRQRRWKLFQEQLLQEKELWITEYALSAVMQK
HLSEKQEKIIQGVVSRLGCLSDESVSYILQKHQLLLCSVLRRLTFRRVGMATLARMRLSR
KKSSLQELREQHTLQKGSSLCQDEDQWQLQKAVESHIREEEEKLEEETQETNLEFHQQLV
TEIQEALQFLQQHMAQVIGQTLLQYARGEAERKSSDDGQDFKEKLVESAVESVYGTSNNI
SRLVQNYYQQLGKITEGYEGKKLQHLKSLQAERNERIRLKSKEKELALKEKHTKGLLNVS
STVHQRVVLQQNKILARFEQQQQIRLESLKQKLLGLHHLETELEKQLREAEQDFVRELAV
LTRVPLTLKRKPSKRSKPAGEKANSKRQTIQSPEPAEKDDSREYIQEPHGKTSGLCREKS
QSSHEGETEPRKNSKMLKKKGSSQDW
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggcggcggtcggggactgcctgcgcgccgtagggctgcagttctgggcggactcagtg
caggctctgcccgccctgctggcccccgccgtgctgctagggctgctgctgggcgccgcc
gccgccgccctgctctgccgctgcgcgctcgggccgcgccggggcggagagaaagattat
tctcaaagacttctggaaagcttcaaccctggtgaaaaagagcacacagttgtgaaaagt
gaagcagagccctatacatcaaaagaggaaatggtgctggaggaaagtgagtctcctctg
aacagtaacatcacagcatttgcattaaaagctaaagtgatctatcctatcaaccagaaa
tttaggcctttggcagatggctcatccaatccatctttgcatgagaatccaaagcaggca
gttctgcctaatcaggtggtggagacatccatgtcaggcagcctgggatctctgagccag
ggagacaaaggggactgtagttcctccacaacaatccattccacaacaagcgatgacaga
tttcaggctcgggccttcctaaaggtggcaagcttccctgaagtgctgacatgtgaaagt
tttgatgttaagctctgcctttgcagtcttattttaaaagatctcatgcttcttgatact
gaactcagaaaagaaaaacatgtgatgtttattcagattttcaagatatacctcacagac
ttccatcgtaaaaagaagattactgatggtttgttgaagaagatccttttaaatcaggaa
aataattttggagaattacagaaacaacttgactccagactccagaatactgaaatgtca
ggagggcataatttggagttccagactctagaagacatagaaaggaaggaaagggagtac
tccgagcacgtaatagataatatggaagccttctggaagcagactgacaaagcccagcag
gactttttggaccaatcaaaatgctcaagtgccaaagcagcaaagataatgatggatctg
actgagaagatgattgcagtagaaagcttgttaagtgaatctcaagacttgcaggcgatg
gacattcaggaaaggttattcaactgggagctaatggtgaaaatgatcgattcactgaag
tcctctataccagaagagtgtaaaggtagattaaatactgtgtcaaatattctggaccac
ttaactgtaaagaataatctttcagtccgacaaaaggaagaacttctaacagatctgcac
aaggccttctgggagcagctggcacattacagtaatgaatgcattcaacagagtaaagac
ctgatcttgaaacggctggagcgccgtgcagagaagaaggaagagttcagacgtagacag
gaagctgaacaagagagtctacttaacaaaacttttcttactgaagatgttcataatttt
ctcaaggcttaccatgagctgatggagaaacactggcaagcacagtgggatctggaggag
gaggatgactgtgagagcgcagaggctgtcaccgatctgtacaaggagctgtactctaag
gcttcccatgctttagcagagttggtgacggagctgtttcttcagaccctgcctgtggtg
accagtctctctgtaagagaatgtgagcttctgaaggaggaatggcaggagaatttggtc
cctgagctggagaaatgggagaaccaccgccagagacgctggaagcttttccaggaacag
ctgttgcaagaaaaagaactctggataacggaatatgctctgtctgctgtgatgcaaaag
cacctgtctgagaaacaagagaagataattcaaggtgtcgtaagcagactaggatgcctc
agcgatgagtctgttagctatatattgcaaaagcaccaacttctgctgtgttcagtactc
agaaggttaaccttccgaagagttggaatggcaaccctggcgcgcatgcgactgtccaga
aagaagagctcgcttcaggagctgagagagcagcataccctgcagaagggatcctccctg
tgccaagatgaggaccagtggcagttacagaaggcagtggagtcccacattcgtgaagag
gaagagaagcttgaggaagaaacacaagaaaccaatttagaatttcaccagcagctagtc
acagaaatccaagaagctcttcagtttcttcagcagcacatggcgcaggtgattgggcag
acactgctgcagtacgcccggggggaagctgaaagaaagagttcagatgatggacaggac
ttcaaggagaaactggtggaatctgctgttgaaagtgtgtatgggaccagtaataatatc
agtagactggtgcaaaactactaccagcaattaggaaaaatcacagaaggctatgaagga
aaaaagctccaacatctgaaatccttacaagcagaaagaaatgaaaggatcagactgaag
agtaaagagaaggaactggcattgaaggaaaaacacaccaaaggcctcctaaatgtgtca
tccacggtccaccaaagggtagtgctacagcaaaacaagattttggctcggtttgaacag
cagcaacaaattcgtctggagtctctgaaacagaagctgctgggattgcaccacctagaa
actgagttggagaagcagctaagggaagcagagcaggactttgtgagagagttggctgtg
ctgacccgagttccactgactctgaagaggaagccttccaaaaggagcaagccagcaggt
gaaaaagcaaattccaaaaggcagaccatccagtcacccgaaccagcagaaaaagatgat
tctcgtgaatatattcaagagccccatggaaaaacttctggcttatgcagagagaagtca
cagagttcacatgaaggggagactgaaccaaggaaaaactcgaagatgttaaaaaagaaa
ggcagcagccaagactggtaa

DBGET integrated database retrieval system