KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105209Help
Entry
102105209         CDS       T02921                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00590  Arachidonic acid metabolism
phi01100  Metabolic pathways
phi04370  VEGF signaling pathway
phi04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102105209 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102105209 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102105209 (PTGS2)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102105209 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102105209
NCBI-ProteinID: XP_005531373
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MPLLPLALLAALLAAGRAANPCCSNPCQNRGVCMSAGPDRYECDCTRTGYYGQNCTTPEF
FTWLRLALKPSPNTVHYILTHYQGAWNIINNIPFLRDTIMRYVLTSRSHLIDSPPTYNSD
YSYKSWEAYSNLSYYTRSLPPVGLDCPTPMGVKGKKELPDSNLIVEKFLLRRKFIPDPQG
TNVMFTFFAQHFTHQFFKTDHKRGPAFTRALGHGVDLNHIYGETLERQLKLRLRKDGKLK
YQMINGEMYPPTVRDTQAEMLYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVC
DVLKHQHPDWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQY
QNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGR
VAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFRSFEELTGEKEMAAELEE
LYGDIDAMELYPGLLVEKPRPGAIFGETMVEMGAPFSLKGLMGNAICSPEYWKPSTFGGK
VGFDIVNTASLQKLICNNVKGCPFTAFHILPPEPTEATINVSTSKTAMEDINPTLLLKER
SAEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgctgcccctggccctgctggccgcgctcctggccgccggccgcgccgccaac
ccttgctgctcgaacccctgccagaacagaggtgtctgcatgagcgctgggccagatcgc
tacgagtgcgactgcaccaggacaggctactacgggcagaactgcaccacaccggaattc
ttcacgtggctgaggctagcactgaaaccatcaccaaacactgtccactacatcctcacc
cactaccaaggagcctggaatatcatcaacaacattcccttcctacgggacactattatg
agatatgtactaacttcaagatcacacttgattgacagcccaccaacttacaatagtgac
tacagttacaaaagctgggaagcttattccaatctttcctactacacgagaagccttcca
ccagtaggacttgactgcccaacaccaatgggtgttaaaggcaagaaagagctcccagat
tcaaatctgattgtggagaagtttttgctgaggagaaagtttattcctgacccgcaaggc
acaaatgtgatgttcacgttctttgcccagcacttcacccaccagttcttcaagacagac
cacaagcggggccctgccttcaccagagcgctcggccacggggttgacttgaaccacatt
tatggagagactctggagagacaacttaaactgaggcttcgaaaggatggaaagctaaaa
taccagatgatcaatggagaaatgtacccgccgaccgtgcgggacacacaggcagagatg
ctgtacccgccccatgtgcctgagcacctgcagttctctgtggggcaggaggtgtttggt
ctggtgccagggctgatgatgtatgccacgatctggctgcgcgaacacaaccgcgtctgc
gatgtgctcaagcaccagcaccctgactgggacgatgagcagctcttccagaccacccgt
ctcatactgataggagagacaatcaagatcgttatagaggactatgtgcagcacctgagc
gggtaccacttcaagctgaagtttgaccccgagctgctgttcaaccagaggttccagtac
cagaaccgcattgcagccgaattcaacaccctgtaccactggcacccactgctgcctgac
accttccagatccatgaccaggagtacaccttccagcagttcctgtacaacaactccatc
atgctggagcatggactctcccatatggtcaaatctttctccaagcaaagtgctggcagg
gttgctggtgggaagaatgttcctgctgcagtacagaaagtggcaaaggcctccattgac
caaagcagacagatgaggtaccagtccttgaatgagtacaggaaacgcttcatgctgaaa
ccattccgatcctttgaagagctaacaggagaaaaagagatggcagcggagctggaggag
ctgtatggggacattgatgccatggagctgtacccaggcctgctggtggagaagccccgg
cccggggccatctttggcgagaccatggtggaaatgggggcaccattctccctgaagggg
ctgatgggcaatgccatctgctcccctgagtactggaagcccagcaccttcgggggcaag
gtgggctttgacatcgtcaacacagcctccctgcagaagctcatctgcaacaacgtgaaa
ggctgtcccttcactgccttccacatcctgcctcctgagcccactgaggccacgattaat
gttagtacctcaaaaactgccatggaagatatcaaccctacgcttctgctgaaagagcgc
tctgccgagctgtag

DBGET integrated database retrieval system