KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105244
Entry
102105244         CDS       T02921                                 

Gene name
HHAT
Definition
(RefSeq) hedgehog acyltransferase
  KO
K24678  protein-cysteine N-palmitoyltransferase HHAT [EC:2.3.1.-]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102105244 (HHAT)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     102105244 (HHAT)
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 102105244
NCBI-ProteinID: XP_014108295
LinkDB
Position
Un
AA seq 495 aa
MLLPAWELCLYGLLTVGSHLYAFYEAHQVSRKYEAAMDRRFGLDPGTLFWGLKKDPMDFE
WSYWIEWGRERILWLLAGHLLVSQMSRLLVEKYKPWCLMVYGMAACWLLLGIKGFAVILL
HAAISFAVAQFQLSLLTWLCSLILLSTLRIPAVEETKRKWYDTENEYYLLLFTVSVRCLF
CTSFSLEYCWHAPTQKSSHSFPWMLAYVFYYPTFHNGPLVNFDEFSKQMRTQEAFSVKTN
LSILIVGIIRIFFWWCLAELMIHLMYIHALYSSALPLESASYWALGGLALAQVLFFYVKY
LVLYGVPGLLLQMDGLKPPALPCCVSLMHSFTKMWRSFDVGLHRFLVRYIYVPMGGSQSS
LLGTLLSTALTFAFVSYWHGGQSYLWCWGALNWLGVVVENVTKRILSISLIQDLIERFFS
PRFRRRLHAVLASVSTSMLILSNLIFLGGNQVGKIYWNRIFIEGEEDKTDLLYESVQSLV
LKKLLGQSQIQTEAD
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgctgctgccggcctgggaactgtgcctctacgggctcctgaccgtgggctcccacctc
tacgctttctacgaagcgcaccaagtgtctcgaaagtatgaagctgcaatggacagaaga
tttgggctggacccaggaactctcttttgggggctaaaaaaggaccccatggactttgag
tggagctactggattgaatggggaagggaacgtatactgtggcttctggctggtcacctg
ctggtatcacaaatgtccaggctcttggtggagaagtataaaccgtggtgcttgatggtt
tatggaatggctgcctgctggttattattgggaatcaagggttttgccgttattttgtta
catgcagctatttcctttgctgtggcgcagtttcagctgtcactcctgacatggttgtgc
tcccttatccttctgtccactttgcgcataccagccgtggaagaaaccaagagaaagtgg
tatgacactgaaaatgagtattacctgctgctcttcactgtgtctgtccgatgcctcttc
tgcactagcttcagcctggagtactgctggcatgcacctacccagaagtcatcccactca
ttcccctggatgctggcatatgtgttttattatcctacattccacaatggaccccttgtg
aattttgatgagttcagtaagcagatgaggacacaagaagctttcagtgtgaagaccaat
ctcagcatcttaattgtgggcataattcgtattttcttttggtggtgcctggctgagctg
atgattcacctcatgtatatccatgctctctacagtagtgctctgcctttggaatctgca
tcttactgggccttgggtggcctggctttagctcaagtacttttcttttatgtgaaatat
ctggttctgtatggtgttcctggcctcctccttcaaatggatggactcaaacctccagct
ctaccttgctgtgtgagcctgatgcacagtttcaccaaaatgtggagaagttttgatgtt
gggctgcatcgctttctggtcaggtacatttatgttccgatgggaggatctcagtccagt
ctgcttggaacactattatctacagccctcacttttgccttcgtaagctactggcatgga
ggacagagttatttgtggtgctggggtgcacttaattggcttggagtagttgtggaaaat
gtcaccaagaggatactttcaatttcacttattcaagatttaattgaacgtttcttctcg
ccaagatttcgtcgtcgacttcatgctgtcctagcatctgttagcacttcaatgttgatt
ttatcaaatctaatatttcttggaggaaatcaagttggaaaaatttactggaacaggatc
tttatagaaggtgaagaagataaaacagatttactttatgagagtgtccagtccttggtt
ttgaagaagctcttgggacagtcccagatccaaacagaggctgattga

DBGET integrated database retrieval system