KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105366
Entry
102105366         CDS       T02921                                 

Gene name
MGRN1
Definition
(RefSeq) mahogunin ring finger 1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04120  Ubiquitin mediated proteolysis
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102105366 (MGRN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102105366 (MGRN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phi04121]
    102105366 (MGRN1)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102105366 (MGRN1)
Ubiquitin system [BR:phi04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102105366 (MGRN1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 102105366
NCBI-ProteinID: XP_005522888
LinkDB
Position
Un
AA seq 536 aa
MGSLLSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYITPAPHEPVKTLRSLVNIRKDSLRLVRYKDDVDSPTEENGKQKVLYSL
EFTFDADARVAITIYCQATEEFVGGMAVYSTKNPSLQSETVHYKRGVSQQFSLPSFKIDF
SEWKDDELNFDLDRGVFPVVIRAVVDEGDVVVEVTGHAHVLLAAFEKHVDGSFSVKPLKQ
KQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLC
NSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSVDHDEHSSSDN
IPPGYEPISLLEALNGLRSVSPSIPSAPLYDEISYSGVVDGMPPTSRPLVAMDRALEGGH
QKGKCSKSPDSTLRSPSSPIHEEDEEKLSEDSDSQAVLSGGELVLRETSSPESVAGEEME
EASSMQQGSRPPSVEDVLQDGGCGESRSLTQSESDPPVDVFLPALGPDSCSVGIEE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggctccctgctcagccggcgcatcgcgggcgtggaggacatcgacatccaggccaac
tcggcctaccgctacccgcccaagtccggaaactactttgcaagtcacttctttatggga
ggcgaaaagtttgacacccctcaccctgagggttacctttttggtgagaacatggactta
aacttccttgggaatagaccagttcagtttccctatataactccagctccacatgagcca
gtgaagacactgaggagtttggtgaacatccgcaaagactctctccgacttgtgaggtat
aaagatgatgttgacagccctactgaggagaatgggaagcagaaggtcctgtacagcctg
gaattcacctttgatgcagatgcccgtgttgccatcacaatctactgccaggctacagag
gagtttgttggtggcatggccgtatacagcacaaagaatccctctctgcagtccgagaca
gttcattacaagagaggggtaagccagcaattctccctgccttccttcaagattgatttc
tcagagtggaaggatgatgagctgaactttgacttggaccgtggcgtgttccctgtggtc
atccgagcagtggtggatgaaggggatgtggtggttgaggtcactggtcatgcccatgtt
cttctggctgcatttgaaaagcacgttgatggcagtttttctgtgaaaccgctaaaacag
aagcaaattgttgaccgggtgagctacctgcttcaggagatctacggcatcgagaacaaa
aacaaccaggagaccaagccttcagacgacgagaacagcgacaacagcaacgagtgcgtg
gtttgtctgtcggacctgcgggacaccctcatcctgccctgccgccacctctgcctctgc
aactcctgtgctgacaccctgcgctaccaggccaacaactgccccatctgcaggctcccc
ttccgtgccctgctgcagatccgggcggtgaggaagaagccgggggctctgtcgccggtg
tcgttcagccctgtcctggcacagagcgtggaccatgatgagcactctagctctgacaac
atccccccaggctacgagcccatctcgctgctggaagcgctgaacggccttcgctcggtg
tcgccctccatcccctcggcccctctgtacgacgagatcagctactccggggtggtggac
gggatgcctcccaccagccgcccgctcgtagccatggacagagccctggagggtggccac
caaaagggcaagtgcagcaagtctccagacagcacactacggtctccctcatccccaatc
catgaggaggatgaggagaagctctccgaggactcggactctcaggcggtgctgagtggg
ggtgagctggtcctgagggagaccagctctccagagagcgtggcaggggaagagatggag
gaggcctcatccatgcagcagggtagccgcccgccctcggttgaagatgtgctgcaggat
ggcggctgcggcgagagccggagcctgacgcagtccgagagtgaccccccagttgacgtc
ttcctgccagcactgggtcctgattcctgctctgttggtatagaggagtaa

DBGET integrated database retrieval system