KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105464Help
Entry
102105464         CDS       T02921                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00010  Glycolysis / Gluconeogenesis
phi00052  Galactose metabolism
phi00500  Starch and sucrose metabolism
phi00520  Amino sugar and nucleotide sugar metabolism
phi00524  Neomycin, kanamycin and gentamicin biosynthesis
phi01100  Metabolic pathways
phi01200  Carbon metabolism
phi04910  Insulin signaling pathway
Module
phi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
phi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102105464 (GCK)
   00052 Galactose metabolism
    102105464 (GCK)
   00500 Starch and sucrose metabolism
    102105464 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102105464 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102105464 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102105464 (GCK)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102105464 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102105464
NCBI-ProteinID: XP_005532965
LinkDB All DBs
Position
Un
AA seq 465 aa AA seqDB search
MLDHRARMESSRKEKVEQILSEFHLKEEDLKKVMYRMQKEMDRGLKLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLKLVDENLLFNGEASEKLKTRGTFETRFMSQIESDSDDRKQIYNILSAFELLPS
RTDCEIVRRVCESVSTRAAQMCSAGLAGVINRMRESRSQDTLKITVGVDGSVYKLHPSFK
DHFHATVRQLTPGCDITFIQSEEGSGRGAALISAVACKMACMMGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcaccgagccaggatggagagcagcaggaaggagaaggtggagcagatcctg
tcagagttccatctgaaggaggaggacctgaagaaggtgatgtaccggatgcagaaggag
atggaccgagggctcaaactggagacacatgaggaagcctctgtcaaaatgctgcccacc
tatgtccgttccacccctgagggctccgaggtgggagatttcctgtcactggacctgggt
ggcaccaatttccgtgtgatgctggtgaaggtgggcgagggggaggaggggcagtggaag
gtgaagacgaagcaccagatgtattccatcccagaggatgccatgaccgggacggcagag
atgctttttgactacatctccgagtgcatctctgatttcctggacaagcaccagatgaag
cacaaaaagctgcccctgggcttcaccttctccttccctgtgcggcacgaggacatcgac
aagggcatcctcctgaactggaccaagggcttcaaagcctccggcgcggaagggaacaac
gtggtggggctgctgagggacgccatcaaacggcgaggggacttcgagatggatgtggtg
gcaatggtgaatgacacagtggccacgatgatctcctgctactacgaagatcaccggtgc
gaggttgggatgattgtggggacgggctgtaatgcctgctacatggaggagatgcacaac
gtggagctggtggagggcgacgaggggcggatgtgtgtgaacacggagtggggagccttt
ggtgcctctggggagctggacgagttcctcctggagtacgaccgcgtggtggacgagacc
tcacttaaccccggtcagcaactgtacgagaagatcattggagggaagtacatgggggaa
atcgtgcggctggtgctgttgaagctggtggatgagaacctgcttttcaatggggaggcc
tctgagaagctcaagactcgtgggacttttgagacccgcttcatgtcccagattgagagt
gattctgatgaccgcaagcagatctacaacatcttgtcagcctttgagctgctgccatct
cggacagactgtgagatcgtgcgccgggtgtgtgagagcgtgtccacacgggctgcccag
atgtgttcggccgggctggccggcgtcatcaaccgcatgcgggagagccgcagccaggac
accctcaagatcactgttggtgttgatggctccgtctacaagctccatcccagcttcaag
gaccacttccatgccacagtgcggcagctgacgcctggctgtgacatcacgttcatccag
tcagaggaaggcagtgggcgcggggccgctctcatctcagccgtggcctgcaagatggcc
tgcatgatggggcagtga

DBGET integrated database retrieval system