KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105491
Entry
102105491         CDS       T02921                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04012  ErbB signaling pathway
phi04110  Cell cycle
phi04150  mTOR signaling pathway
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
phi04510  Focal adhesion
phi04910  Insulin signaling pathway
phi04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102105491 (GSK3B)
   04310 Wnt signaling pathway
    102105491 (GSK3B)
   04340 Hedgehog signaling pathway
    102105491 (GSK3B)
   04150 mTOR signaling pathway
    102105491 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102105491 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102105491 (GSK3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102105491 (GSK3B)
   04916 Melanogenesis
    102105491 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102105491 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102105491 (GSK3B)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     102105491 (GSK3B)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   102105491 (GSK3B)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102105491 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 102105491
NCBI-ProteinID: XP_005523941
LinkDB
Position
Un
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDKPALF
NFTTQELSSNPSLASILIPAHARNQAAASTPTNATAASDVNAGERVQTNSVATASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtccgggcggcccaggaccacctccttcgcggagagctgcaagccggtgcagcagccc
tcggccttcggcagcatgaaagtcagccgagacaaagatggcagcaaggtaactacagta
gtggcaactcctggacaaggtccggaccgaccacaagaagtcagctacacagacaccaag
gtgattggaaatggatcttttggtgttgtgtatcaagccaaactctgtgattcaggagag
cttgtggccattaagaaagtcctgcaggataaaagatttaagaacagagagctccagatt
atgagaaagttggatcattgtaacattgtccgattgcgttacttcttctactctagtgga
gagaagaaagatgaggtgtacctcaacttggtgctggactatgttcctgaaacagtatac
agagttgccagacattatagtcgggccaaacagacgctccctatgatttatgtcaagttg
tacatgtatcagctgttccggagtttagcctatatccattcctttgggatctgccaccgg
gatataaaaccacagaacctcttgctggaccctgatacagctgttctaaaactctgtgac
tttggaagtgcaaaacagctggttcgtggagaacccaacgtgtcgtacatctgctctcgg
tactacagggcaccagagttgatctttggagccaccgattatacctccagtatagatgtg
tggtcagcaggctgtgtattggctgaactgttactaggacaaccgatctttccaggtgac
agtggtgtggatcagttggtggaaataatcaaggttctgggaacgcctacaagggagcaa
attagagaaatgaatccaaactatactgaattcaaatttcctcagattaaggcacatcca
tggactaaggtcttccggccccgcactccccctgaagcaattgcgctatgtagccgcctg
ctggagtacacccccaccgcccgcctgactcccctggaggcctgcgcccactctttcttc
gatgaactacgggacccaaacgtcaagttaccaaacgggcgagataaacctgcactcttc
aatttcaccactcaagaactgtcaagtaacccatctctggcttcgatcctcatccctgct
catgcccggaaccaagcagctgcttcaacccctacaaatgctacagcggcctcagatgtt
aacgcaggagaacgagttcagaccaatagtgtagctacagcatcagcctccaactccacc
tga

DBGET integrated database retrieval system