KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106069
Entry
102106069         CDS       T02921                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04020  Calcium signaling pathway
phi04260  Cardiac muscle contraction
phi04261  Adrenergic signaling in cardiomyocytes
phi04270  Vascular smooth muscle contraction
phi04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102106069 (CACNA1C)
   04020 Calcium signaling pathway
    102106069 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102106069 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102106069 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102106069 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102106069 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phi04040]
    102106069 (CACNA1C)
Ion channels [BR:phi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102106069 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102106069
NCBI-ProteinID: XP_014114776
LinkDB
Position
Un
AA seq 2182 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKSFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNV
PGADMEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEMEKTAVEEETKEEKIELKSITADGESPPATKINVDDYQPNESEEKSPYPT
TEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVND
NIFTNLILFFILLSSISLAAEDPVRHLSFRNQILFYFDIVFTVIFTIEIALKILGNADYV
FTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRV
LRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCT
DSSKQTEAECRGYYITYKDGEVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPE
LLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKN
CELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQ
HYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVI
LSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLF
RVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTT
EINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSF
AVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGR
IKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALR
IKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKF
KKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAAS
EDDIFRRAGGLFGNHVSYYQSDGRSGFPQTFTTQRPLHINKSGNNHGDTESPSHEKLVDS
TFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTICVQEAPWKL
PSKSSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTP
PENNKGEDTRPSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQAL
AVAGLSPLLQRSHSPTMFSRLCATPPATPCNRGWPQQSIPTLRLDGAESSEKLNSSLPSV
HCGSRYPEGGGSPRRARPVSLTVPSPSAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKF
IEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEV
QNPDCRISQEELKDSRIYISSL
NT seq 6549 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccagaagaaaaccatcaaggttccaactat
gggagtccccgtccggctcacgccaacatgaacgccaacgcggcggcggggctggccccg
gagcacatccccacgccgggggcagccctgtcctggcaggctgccatcgatgctgccagg
caggccaagctgatgggcagtgctggcaacgccaccatttccacggccagctccacgcag
aggaagaggcagcagtacggcaagcagaagaagcagggcagcaccacggccacgcgcccg
ccgcgcgcgctgctgtgcctgacgctgaagaatcccatccggagagcgtgcatcagcatc
gtcgaatggaaatcatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tacggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcgataggaggaaaaggtgccggatttgatgttaaagcactgcgggctttccga
gtattacgtccactacggctggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcatattgccctgctggtgctgtttgtcattatt
atctatgccatcattggactggagttattcatggggaagatgcataagacctgctaccat
gtgcaagggggactgatagatacacctgcggaggacgacccgtctccgtgtgccccccag
tctgcccacgggcggcagtgtcagaacggcaccgagtgcaaggcgggctgggagggacct
aagcacggcatcaccaactttgacaattttgcttttgccatgctcacggtgtttcagtgc
atcaccatggagggctggacggatgtgctgtactgggtcaatgatgccataggaagggac
tggccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttg
gttctcggtgtacttagcggggagttttccaaagaaagagaaaaggctaaagctcgaggg
gatttccagaagctacgggaaaagcaacagctagaggaggatctgaagggatacttagat
tggataactcaagcagaagacattgatccagaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacatgagcatgcccaccagcgagaccgagtccgtcaacaccgacaacgtc
cccggagcggacatggagggcgagaactgcggcgccaggctggcgcatcggatctcaaaa
tcaaaatttagtcgctactggcgccgatggaaccgattctgcagaaggaagtgccgtgct
gctgtcaagtccaatgttttctattggctggtgatcttcctcgtgtttctcaacaccctc
accattgcctctgagcactacaaccagccagactggctcacagaggtccaagacactgcc
aacaaggtgctgctagctcttttcacggcagagatgctgctgaagatgtacagcctcggt
ctccaggcctactttgtgtccctcttcaaccgctttgactgcttcatcgtgtgcgggggc
atcctggaaaccatcctggtggagacaaagatcatgtcacccctgggcatttcggttttg
agatgtgtcaggctcctaaggatatttaaaatcacaagatattggaactccctgagtaat
cttgtggcttcactcctgaattcagtccgctccattgcctccctgttgctgctcctcttc
ctcttcatcatcatcttctcactcctggggatgcagctctttgggggcaagtttaacttt
gatgagatgcagaccaggaggagtacatttgacaacttccctcagtccctcctgactgtg
tttcagatcctgactggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccaggaatgttggtctgtatttacttcatcatcctcttcatctgt
ggaaactatatcctgctgaatgtatttttggccattgctgtggacaaccttgctgatgct
gagagtttaacatctgcacagaaagaggaggaagaggagaaagaaaggaaaaagcttgct
aggactgctagtcccgaaaagaaacaggagatggaaaaaacagctgtggaggaagagaca
aaggaggagaaaattgagctgaaatcgatcactgctgatggagagtccccacctgctacc
aagatcaacgtggatgattatcagcccaatgaaagcgaagaaaagagcccttatcccaca
acagaagcaccagcagaggaagatgaggaagaacccgagatgcctgtcggccctcgacct
cgcccgatgtctgagctgcacctcaaggaaaaggctgtgcccatgcctgatgccagtgct
ttcttcatcttcagtcctaacaacaggttccgtgtccactgccatcgaatcgttaacgat
aacattttcaccaacctgatcctatttttcatcctgctcagcagcatctccctggcagct
gaggaccccgtgagacacctctcctttaggaaccaaattctcttttattttgatatagtt
tttactgtcattttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtc
ttcactagtatctttacattagaaattattcttaagatgacggcctacggggctttcctc
cacaagggctccttctgcaggaactatttcaacatcttagacctgctggtggtcagcgtt
tctctcatctcctttgggatccagtccagtgccattaatgtggtgaagatcctgcgtgtt
ctgagggtccttagaccactgagggccatcaacagagccaaaggactaaagcacgtggtc
cagtgtgtgtttgtcgccatcagaaccatcgggaacattgtgattgtcaccactttgctg
cagttcatgtttgcctgcattggagttcagctgttcaagggcaagctgtacagctgcact
gacagctccaagcagacagaagcagagtgcagagggtactacatcacctacaaggacggg
gaggtcagccagcccatgatacagccccgcagctgggagaacagcaagttcgacttcgac
aacgtcctgactgccatgatggccctcttcaccgtctccaccttcgagggctggccagag
ttgctgtataggtccattgattcccacatggaggatgtgggacccatctataatcacagg
gttgagatctccatcttctttattatctacatcatcatcattgctttcttcatgatgaac
atcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaacaagagtacaagaac
tgtgagctggacaaaaaccagcgccagtgtgtagagtatgccctgaaagcccggcccctg
cggagatacatccctaaaaaccagtaccagtacaaagtttggtacgtggtcaactccacc
tattttgaatacctgatgttcgttctgatcctgctgaacaccatctgcctggccatgcaa
cactatggtcagagctgcatgttcaaggaagccatgaacatcctcaacatgctcttcact
ggcctcttcaccgtggagatggtcctgaaattaatcgccttcaaacccaagggttacttt
agtgatccttggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcatt
ctcagtgaaactaatcactatttctgtgatgcatggaatacatttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgc
tcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccgactcttc
cgcgtgatgcgcctcgtgaagctcctgagccgaggggagggcatccggacgctgctttgg
accttcatcaagtccttccaggctctcccctacgtggctcttttaatagtgatgctgttc
ttcatctacgctgtgattgggatgcaggtgttcggtaaaatcgcgctgaacgacaccaca
gaaatcaaccgcaacaataacttccagaccttcccccaggcagtgctgctgcttttcagg
tgtgccacaggtgaggcctggcaggaaatcatgctggcatgtctcccggacaagaagtgt
gacccggagtcggagccggccaactccacggaagccgatcactcctgtggcagcagcttc
gccgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaatcttttt
gtagctgttataatggataacttcgattacctgacacgggactggtccattttaggacca
caccacctggatgagtttaaaaggatctgggcagagtatgaccctgaagctaagggacgg
atcaaacacttggatgtggtgacgctgctccggcggatccagcccccgctgggcttcggg
aagctctgcccccaccgcgtggcttgcaaacgccttgtctccatgaatatgccactgaac
agcgatggcaccgtcatgttcaatgccactctctttgcactggtcagaactgcactgagg
atcaagacagaaggtaacctggagcaagccaacgaagagctgagagcaataattaagaaa
atctggaagcgcaccagtatgaagctgctggaccaggtggtgcctcctgcaggtgatgac
gaggtgaccgtggggaagttctacgccactttcttgatccaggagtatttccggaagttc
aagaagcgcaaggagcaggggctggtggggaagccctcgcagcgcaacgcgctgtcctta
caggctggtctgcgcacactccacgacatcgggccggagatccgacgagcaatttctgga
gacctgacagctgaagaggagctggacaaggccatgaaagaagctgtttctgctgcctct
gaagatgatatcttccggagagctggaggcttgtttggaaaccacgtgagctattaccaa
agtgacggcaggagcgggttcccccagacattcaccacccagagacctttgcacatcaat
aagtctggcaacaaccacggagacaccgagtctccatctcatgagaagctggtggactcc
accttcactcccagcagctactcatcctcaggctccaatgccaacatcaacaatgccaac
aacaccgccctgtgtcgcttccccagcccacccagctaccccagcactgtcagcacagtg
gaaggccatgggacccccttgtcacccaccatttgtgtgcaggaggctccctggaaactc
ccatccaaaagctccagttccagagacagccagctggcaattgtttgccaagaggaagtg
tctcaggatgagacttatgatgaaaatttgaatgaagacattgagtactgtagtgaacca
agtctgctctctaccgaaatgcttgcataccaggatgatgaaaacagacaactcactccg
ccagaaaacaacaaaggagaggacacccggccctctccgaagaaggggtttctgtgctcc
tcagctctaggtcgaagagcatcttttcacttagagtgtttgaaaagacagaagaaccag
ggcgtggatgtctcgcagaagacagtcctgcctttgcatctggtccatcatcaggcatta
gcagtggccggcctgagtcccctgctccagcgaagccattcccccaccatgttctctcgg
ctgtgtgctacacccccggccacgccctgcaaccgaggctggccgcaacagagcatccca
acgctgcgcctcgacggggcggaatcctcggagaagctcaacagcagcttgccgtcggtg
cactgcggctcccggtaccccgagggcggcggcagccccaggagagcccggccggtgtcc
ctgaccgtgcccagccccagcgcaggcagcagccggcagttccacggcagcgccagcagc
ctggtggaagcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttc
attgaggtcacaacccaggagctcgcagacgcctgcgacatgacgatagaagagatggaa
aatgcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctcttg
ccttttgctaactgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtg
cagaacccggattgtaggataagtcaggaggagctcaaggacagcaggatttatatcagc
agcctgtag

DBGET integrated database retrieval system