KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106146Help
Entry
102106146         CDS       T02921                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phi01002]
    102106146 (TMPRSS9)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102106146 (TMPRSS9)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102106146 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102106146
NCBI-ProteinID: XP_005531459
LinkDB All DBs
Position
Un
AA seq 1077 aa AA seqDB search
MEQINTGQGTQRRRLGACCWKVTAAAAVVGSATALCLGILLACHSTGEASFEHTVELKGI
TFNSSLQMENSDYYRVLTPALERLFLSSLQDSQLNWSCTGCTILGYSRNGNSGVIVHFRL
LFTPQDSQPLSSILEEEALRHGLAAALHKQAFSLAAYGTISSASLTGPNKVSSHRPGLKS
DCGSRPAMQTASRIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQ
DPAMWAAYTGTTSLRGSDSSAVKMDISRIIPHPSYNADTADYDVAVLELKRPVTFTKYIQ
PVCLPDAGHHFPTSKKCLISGWGYLKEDFLVKPDFLQKATVELLDQNLCSSLYSHVLTDR
MMCAGYLEGKVDSCQGDSGGPLVCQEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTKLRD
WILDAISAFPTSIAYTVPPVHFRTNSNMVSAEEVNTTTGATPTTSPAPAASRPVTAARPQ
ECGGQPGFSTPSKIVGGTDASRGEIPWQVSLKEDSRHFCGATIIGDRWLLSAAHCFNETM
PEEIEAYVGTTSLNGTDENAVKVSVKRVVPHPLFNPMILDFDVAVLELARPLVFNKYIQP
VCLPLAVQKFPVGKKCLISGWGDLQEGNDTKPKILQKASVGIIEQNTCNFLYNFSLTDRM
ICAGFMEGMVDSCQGDSGGPLACEVTPGVFYLAGIVSWGFGCAQAMRPGVYSRITKFTDW
ILDTISQLPSDGTSTPSSSAIPRTSAMAIFIQPSTMAASPTSRTTLETKMNRTMNETSTA
LRTTETEKPTQTPVVPCTSLTFKCSSKVCIGKENPECDGVVDCSNGFDERNCDCGLTTAL
AFSKIVGGSSAAQGEWPWQVSLWLRRKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAF
LGTPFLSGINGKMEKIFRIYKHPFYNVYSLDYDVALLELSTPVKFSSTIRPICLPDNSHI
FHEGARCFITGWGSTKEGGLMSKHLQKAAVNMIGDQACKKFYPVQISSRMLCAGFPQGTV
DSCSGDAGGPLACKEPSGKWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIVQNLKL
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggagcagataaacacagggcaaggcacccagagaaggagactgggggcctgctgctgg
aaggtaaccgctgctgctgctgtggtgggcagtgcaacagccctctgcctggggatcctg
ctcgcctgtcattccacaggagaggccagctttgagcacacagtggagctgaaaggaatc
acattcaacagcagcttacagatggagaactcagactactatagggtgctgacacctgct
cttgaaagactgtttctatccagtctccaggactcccagctgaactggagttgcactggt
tgcactatcctgggctacagtaggaatggaaattccggtgtgatcgtccatttccgcctg
ctcttcactccccaggattcccaacccctgagctctatcttggaggaggaagctctgagg
catgggctggcagctgccctgcacaagcaagctttctccctggctgcctatgggaccatc
tcctcagcttctctcacaggtcccaacaaggtttcttcccacagacctggactgaaatca
gactgtgggagtcgccctgccatgcagactgccagcaggatagttggaggctcagaggcg
tccagaggggagttcccgtggcaagtcagcctacgagagaacaatgagcacttctgcggg
gctgcgatcctcacagagaagtggctggtgtctgctgctcactgctttactgagtttcag
gacccagccatgtgggcagcttacactgggaccacatccctcagaggctctgacagcagt
gcagtgaaaatggacatttcacggatcatcccacacccctcttacaatgctgacacagct
gactatgatgtggctgtgctggagctgaagagacctgtgactttcactaagtacatccag
cccgtgtgcctgccagatgctggccatcacttccctaccagcaagaagtgccttatttct
ggctggggctacctcaaggaggatttcttggtgaaacctgacttcctgcagaaagcaaca
gtggagcttctagaccaaaacctatgttccagtctctacagccatgtcctcacagacaga
atgatgtgtgctggctacctggaggggaaagttgactcctgccagggtgactctggtggg
cccctggtttgccaagaaccatctggcagattcttcctggcgggaattgtgagttggggt
attggatgtgctgaagccaggcgccctggggtttacacacgtgttaccaaactcagagac
tggatcttggatgctatttctgccttccctacctccatagcctatactgttcctccagta
cacttcaggactaacagtaacatggtcagtgctgaagaggtcaacaccaccactggagca
actcccaccacctcaccagccccagctgccagcaggccagtgactgcagcaagaccacaa
gagtgtggaggacagcctgggttctctacacccagcaagattgtgggaggaacagatgct
tccagaggagagatcccttggcaagtcagcctgaaagaagattcaagacatttctgtgga
gccaccatcattggggaccgctggctgctgtcagcagctcactgcttcaatgagacaatg
ccagaagagatcgaagcctatgtgggaacaacatccctaaatggaacagatgagaatgca
gtgaaagtcagtgtaaaaagagtggtcccacatcccctcttcaaccccatgattctggac
ttcgatgtggctgtacttgaactggcaagacctcttgtcttcaacaaatacatacagcca
gtgtgcctcccacttgctgtgcagaagtttcctgttggcaagaaatgcctcatttctgga
tggggtgacctgcaggaagggaacgacaccaagcccaagatcctgcagaaagcctctgtg
ggcatcatagaacagaacacctgcaacttcctctacaacttctccctcactgaccgaatg
atctgtgctggcttcatggaggggatggtagactcatgtcagggagattcaggtgggccc
ttggcctgtgaggtgaccccgggagtgttttaccttgccggcatcgtgagctggggattt
ggctgtgcccaggctatgagacctggtgtgtactccagaattaccaaattcacagactgg
atcctggacaccatctcccagttgcccagtgatggcacaagcacaccttccagttcagcc
atccctagaacttctgccatggccatttttatccagcccagcacaatggctgcaagtcca
accagcagaaccaccctggagacaaagatgaacagaaccatgaatgaaacttccacagct
ctgagaacaactgagactgagaagcctacccaaaccccagtggtgccttgtaccagcctc
actttcaagtgttccagcaaggtctgtattggaaaagaaaatcctgaatgtgatggtgtt
gtggactgcagcaatggtttcgatgagcgcaactgtgactgtggcctaacaactgctctg
gccttcagcaagattgtgggtggtagcagcgcagcccaaggagaatggccctggcaagtc
agtctgtggcttcggcggaaggagcacaagtgtggggctgttctcattgctgaccggtgg
ctgctctctgcagctcactgctttgacatttacagtgaccccaaaatgtgggtggccttt
ctaggaacacccttcctgagtggcatcaatggcaaaatggagaaaatattccgtatctac
aaacaccctttttacaacgtctacagcctagactatgatgtggcactactggaactgagc
acacctgtcaagttcagcagcaccatcagaccaatatgtctcccagacaattctcacatc
ttccatgaaggggccagatgcttcatcacaggctggggctccacaaaggaaggaggtctc
atgtcaaagcatctgcaaaaagcggcagtgaacatgattggagaccaggcttgcaaaaag
ttttaccctgtccagatcagcagcaggatgctgtgtgctggtttcccacagggcaccgtc
gacagctgttcaggtgatgcaggtgggcccctggcatgtaaagaaccttcagggaagtgg
tttctagcaggaatcacaagctggggctatggctgtgccaggccatattttcctggcgtc
tacaccaaagtcacagctgtccagggctggattgtacagaacctgaagctctga

DBGET integrated database retrieval system