KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106303
Entry
102106303         CDS       T02921                                 

Gene name
IQCE
Definition
(RefSeq) IQ motif containing E
  KO
K24677  IQ domain-contaning protein E
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102106303 (IQCE)
SSDB
Motif
Pfam: IQ Leu_zip Tropomyosin_1 betaPIX_CC SlyX YedD DUF2119
Other DBs
NCBI-GeneID: 102106303
NCBI-ProteinID: XP_014108266
LinkDB
Position
Un
AA seq 679 aa
MARGAGEAAAEGELGDDSLSVITCESDTAMKLKKKILHKPPKSPKSPYSSSTQLYPKKAA
AWRSLQGTGSACFENAAVKNPRQMWLGSLKQGMSRALESDVDTGHMRVNISSSTPEYLKE
ALGMKKPKHSRSSSNGYIPGTPDYKEKEDMYDEIIELKKTIQAQKNEGDRMKTKLRRLEE
ENNRKDKQIEQLLDPSRVVTGLKQKIVKLEEQCKEKDNTIKYDSEGAAGVEACTGEFQSD
VKTNNLEEVRLAMETYYEEVHRLQLLLAKSETMRKNTEGRDTQKRLKSLNAAVLRLSRNV
KELQAENQRLKEDLDHVLTSSPPPSKTKNYSEWSRQRLVRRISDLEKKVCAMESSRVSSA
DSEASQVLAVSSSPSVDLDHPASQPLDHGEECCRLQRLVKKLKSDRKALQNLLLSKELDI
KQLLQAKAEVELELQKWQNKIEQKSTEEQTLSEEIQNLTQKVGKLELKMEEEKRQMAEDT
VEKLNKAPPLCTVTSKENHKKEQAAKIIQRYWKMYRTKKEEIALDEAAVLLQAAFRGHLS
RQKVLLDIEVPDAKSPTKNSCLSSMSDCLSFSSDCKERDEIVTFIQSIFRAHLARTGLLQ
ERPSVPSAPSGKADPAVYITEKKPGPAALQRPSVLTSPLPGRSCSAPCAPLDEAHSDDSD
DVVVVVPPLLQVKKSHTHF
NT seq 2040 nt   +upstreamnt  +downstreamnt
atggcccggggggccggcgaggcggccgcggagggggagctgggagatgacagcctgtct
gtgataacctgcgagtcagacacagcaatgaagttaaagaaaaagattcttcacaagcct
ccaaagtcaccaaagtctccctacagctcaagcacacaactgtatcctaaaaaagctgca
gcttggcgatctctgcagggaacgggcagtgcttgttttgagaatgcagctgttaaaaac
ccaaggcagatgtggctgggatctctgaaacaaggaatgagccgtgctctggaatcagat
gttgacacagggcatatgcgagttaacatttccagtagcactccagaatatttgaaggaa
gctctaggaatgaagaagccaaaacattctcgttcttccagtaatggctatattcctgga
actcctgactacaaagagaaagaagatatgtatgatgaaattatagaactgaaaaagaca
atacaagctcagaagaatgagggagaccgaatgaaaacgaagctccgtcgactggaagag
gagaacaatagaaaggataaacagattgaacaactgctggatccttccagggtggttact
ggattaaagcagaagattgtcaagctcgaagagcagtgcaaagagaaagacaacactatt
aagtatgactctgagggggcagcgggggtagaggcttgtactggtgaattccagtcagac
gtgaagaccaataatttggaagaagtgaggttagccatggaaacctactatgaagaggtt
catcgcctccagctcctcctggccaagtctgagactatgaggaaaaatacagagggcaga
gacacccaaaaacgactaaagtcactgaatgctgctgtgctgaggttgtccaggaacgtc
aaggaattgcaggctgagaatcagaggctgaaggaagatctggatcatgtgctgaccagt
tcccctcctcccagtaaaacaaaaaattatagcgagtggagcagacagaggctggtgagg
aggatttcggatctagaaaaaaaagtgtgtgccatggagagcagcagggtgtcctcagct
gatagtgaggcatcacaagtgcttgctgtgtcatcttcaccttctgtggacctggatcat
ccagcatcccaacctttagaccatggtgaggaatgctgtcgcctccaaaggctggtgaag
aaactgaagagtgataggaaggcacttcagaacctcctgctcagtaaagaattagatatc
aagcagttactgcaggctaaggctgaagtagagctggagctgcagaagtggcagaataag
atagaacaaaagagtacagaagagcaaactttaagtgaggaaatccagaacctgacacag
aaagtagggaaactggagttaaaaatggaggaagagaaaagacaaatggcagaagataca
gtggaaaagcttaataaggctccaccactctgcacagtcacaagcaaagaaaatcacaag
aaagaacaagcagccaaaattatccagagatactggaagatgtacagaaccaagaaagaa
gaaattgctctggatgaggcagctgttctgctccaggcagccttcagaggacatttatct
cgacagaaagtgctgctggatatcgaggtgcctgatgcaaagtctcccaccaagaactcc
tgcctgtcttccatgtcagactgcttgagcttttcttctgattgcaaggagagagatgag
attgtgacattcatccagtccattttcagggctcatttagcacgtacaggacttcttcag
gagaggccctctgtgcccagtgctcccagtgggaaagcagatcctgcagtttacatcaca
gagaagaaaccaggcccagcagctctccagagaccttcagtcctcacatctcctctccct
ggcaggtcctgctctgctccctgtgcgcccctggatgaggctcactccgacgactccgac
gacgttgttgttgttgtccctcccttgctgcaggtgaagaaaagccacacccacttctaa

DBGET integrated database retrieval system