KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106559
Entry
102106559         CDS       T02921                                 

Gene name
ARRB1
Definition
(RefSeq) arrestin beta 1
  KO
K04439  beta-arrestin
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04144  Endocytosis
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102106559 (ARRB1)
   04340 Hedgehog signaling pathway
    102106559 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102106559 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phi04131]
    102106559 (ARRB1)
Membrane trafficking [BR:phi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    102106559 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 102106559
NCBI-ProteinID: XP_005524198
LinkDB
Position
Un
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCA
FRYGREDLDVLGLTFRKDLFVANSQAFPPVPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAVEDADDMVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
VHRDIPENEAPIDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEDEEERTNSPQLNDR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggagacaaaggcacccgggtgtttaagaaagccagtcctaacgggaagctcactgtc
taccttgggaagagggatttcgtggaccacatcgacgtggtggaccccgtggatggagta
gtcctggtggatcctgaatacctgaaggagagaaaagtctttgtgacattgacctgcgcc
ttccgctatggccgtgaagacctggatgtcctggggctcaccttccgcaaggacctgttc
gtggccaattcccaggctttcccccctgtccctgaggacaaaaagccgctgacacggctg
caggagcggctcatcaagaagctgggcgagcacgcctaccccttcacctttgagatcccc
cccaacttgccttgctctgtcacgctgcagccaggcccagaggacacagggaaggcctgt
ggggtggactacgaggtcaaagctttctgtgctgagaacctggaggagaagatccacaag
aggaactcggtgcgccttgtgatccgtaaggtccagtatgcaccagagagacccggcccc
cagcccatggcagagaccacccggcagttcctcatgtcagacaagccactgcaccttgag
gcatccctggacaaggagatctactaccacggggagcccatcagtgtcaacgtgcatgtc
accaataataccaacaagaccgtgaagaaaatcaagatctcagtgcgccagtatgccgac
atttgcctcttcaacactgcccagtacaagtgcccagtggctgtggaggatgctgatgac
atggtggccccgagctcgacgttctgcaaagtctacaccctaactcccttccttgccaac
aaccgggagaaacgggggctggcgctggatgggaagctcaagcacgaggacaccaacctg
gcctccagcacactgttaagagatggagccaataaggagatcctgggcattattgtctcc
tataaggtgaaggtgaaactggtggtgtcacgaggaggcctgctgggagacctcgcctcc
agtgatgttgcagtggagctgcccttcacgctgatgcatcccaaacccaaggaggaacca
gtacaccgggacattccagagaatgaagcacccatagataccaatctgatagagcttgat
acaaacgatgatgacattgtgtttgaagacttcgcccgccagcgactgaaaggcatgaag
gatgacaaggaggatgaggaggagcggacaaattccccgcagctcaacgacagataa

DBGET integrated database retrieval system