KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106672Help
Entry
102106672         CDS       T02921                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00480  Glutathione metabolism
phi00980  Metabolism of xenobiotics by cytochrome P450
phi00982  Drug metabolism - cytochrome P450
phi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102106672 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102106672 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102106672 (GSTO1)
   00983 Drug metabolism - other enzymes
    102106672 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phi02000]
    102106672 (GSTO1)
Enzymes [BR:phi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102106672 (GSTO1)
Transporters [BR:phi02000]
 Other Transporters
  Pores ion channels [TC:1]
   102106672 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 102106672
NCBI-ProteinID: XP_005520774
LinkDB All DBs
Position
Un
AA seq 242 aa AA seqDB search
MSGDHSRSLGKGSAAPGPVPAGLLRLYSMRFCPFAQRTRLVLRAKDISHEIININLKNKP
DWYFEKNPSGLVPVLETSKGQLIWESPITCEYLDEAFPGKKLMPSDPYERACQRMLLEDF
SKITPLLFKHVLAVKDGQDTTALKAEIAEKFGKLEEVLSKRNTVFYGGDSISMVDYMIWP
WFERLEAFQLKDCLNHTPKLQRWMEAMKEDPAIKATITDPQTYKNYLQLYLQNSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgatcactcccgcagcctgggcaagggcagcgcggcgccgggccctgtgccc
gcggggctgctccggctctacagcatgcgcttctgccccttcgcgcagcggacgcgcctg
gttctccgcgccaaggacatcagccatgaaataatcaacatcaatctgaagaacaaacct
gactggtactttgagaagaacccctctgggctggttcctgttctggagaccagcaagggc
cagctgatctgggagtccccaatcacctgtgagtacttggatgaagcatttccagggaag
aagctgatgccttcagacccgtatgagcgagcctgtcagaggatgctcttggaagacttc
tcaaagataacacccttgcttttcaagcatgttttggcagtcaaagatggacaggacacc
actgcactgaaagcagagattgctgaaaagtttggcaagcttgaagaggttctgtccaaa
cgcaacacggtgttttatggtggggactcaatctcaatggttgactacatgatctggccg
tggtttgaacgtctggaagcattccagctgaaagactgtttgaatcataccccaaagctc
cagcgctggatggaggccatgaaggaggacccagctatcaaggctacaataactgaccca
cagacatacaaaaactacctccagctgtatctgcagaacagccctgaggcatgtgattat
gggctctga

DBGET integrated database retrieval system