KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106824Help
Entry
102106824         CDS       T02921                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00010  Glycolysis / Gluconeogenesis
phi00053  Ascorbate and aldarate metabolism
phi00071  Fatty acid degradation
phi00260  Glycine, serine and threonine metabolism
phi00280  Valine, leucine and isoleucine degradation
phi00310  Lysine degradation
phi00330  Arginine and proline metabolism
phi00340  Histidine metabolism
phi00380  Tryptophan metabolism
phi00410  beta-Alanine metabolism
phi00561  Glycerolipid metabolism
phi00620  Pyruvate metabolism
phi01100  Metabolic pathways
Module
phi_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
phi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102106824 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102106824 (ALDH7A1)
   00620 Pyruvate metabolism
    102106824 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102106824 (ALDH7A1)
   00561 Glycerolipid metabolism
    102106824 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102106824 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102106824 (ALDH7A1)
   00310 Lysine degradation
    102106824 (ALDH7A1)
   00330 Arginine and proline metabolism
    102106824 (ALDH7A1)
   00340 Histidine metabolism
    102106824 (ALDH7A1)
   00380 Tryptophan metabolism
    102106824 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102106824 (ALDH7A1)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102106824 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102106824 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102106824 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 102106824
NCBI-ProteinID: XP_005528167
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MSTLLISQERYAWLRELGLQEENPGVYNGRWGGRGQVVTTYCPANNEPIASVRQGNLEDY
EETVKKAKEAWKVWADIPAPKRGEIVRQIGDALRQKIKVLGSLVSLEMGKIFVEGVGEVQ
EYVDVCDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGVITAFNFPVAVYGWNSAIA
MICGNACLWKGAPTTSLVSVAVTKIIAKVLEDNKLPGAICSLVCGGADIGTAMARDERMD
LLSFTGSTKVGKQVALMVQERFGRSLLELGGNNAIIVFEDADLNLVIPSALFAAVGTAGQ
RCTTARRLFLHESIHDEVVTKLAKAYAQVRIGDPWDPDTLYGPLHTKEAVKMFLDAVEQA
KQQGGSVVCGGKVINRPGNYVEPTIVTGLPHNAPIVHTETFAPILYVLKFKEEEEVFAWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRES
GSDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgctgctgatcagccaggagcgctacgcgtggctgcgggagctggggctgcag
gaggagaacccgggcgtgtacaacgggcgctggggcggccgcgggcaggtggtgaccacg
tactgccccgccaacaacgagcccatcgccagcgtccggcagggtaatttggaggattat
gaagaaacagtaaagaaggctaaagaggcatggaaggtctgggctgatatccctgcacct
aaacgtggagaaatagtgcgacagattggtgatgccctgagacaaaaaatcaaagttctg
ggaagcttggtctctttggaaatgggaaagatttttgtcgagggtgttggggaagtgcag
gagtatgttgatgtctgtgactatgctgttggtttgtcccgaatgattggtggacctatt
ttgccttcagaaagacctggccatgcccttatagagcagtggaatcctgttgggctagta
ggagtcatcacagccttcaacttccctgtggcagtttatgggtggaacagcgcaattgca
atgatctgtggaaacgcttgcctctggaagggtgctcctacaacatcccttgttagtgtt
gctgttacaaagataattgccaaagtcttggaggataacaagttgccaggagcaatctgc
tctctggtttgtggtggagcagatattgggacagcaatggcaagagatgagaggatggac
ctcttgtccttcactggcagcacaaaagtgggcaagcaagtagcacttatggttcaggag
agatttggtcgaagcctgctggaattgggaggaaacaatgccattattgtgtttgaagat
gcagatctgaacctggtcatcccttctgctctatttgctgctgtgggaacagcaggtcag
aggtgcacaactgctagaaggctgtttctccatgaaagcatccacgatgaggtggtgaca
aagctggccaaggcctatgcccaggtccgcatcggagatccatgggatcctgacactctg
tatgggcctcttcataccaaagaagcagtgaaaatgttccttgatgcagtagaacaagca
aaacaacaaggtggctctgtggtctgtggtggaaaggttataaatcgccctggaaactat
gtcgaaccaaccattgtgactggccttcctcataatgcgcctattgtccacactgagacg
tttgcccccatattatatgtgctgaaatttaaggaggaagaggaggtttttgcctggaac
aatgaagtaaaacagggtctttccagcagcatcttcaccaaggatttgggaaggattttc
cgctggcttgggccaaagggatctgactgtggcattgtgaatgttaacatcccaaccagc
ggagctgagattggaggtgcttttggtggtgaaaagcacactggtgggggaagagaatct
ggaagtgattcatggaaactttatatgagacggtctacttgtacaatcaactacagcaaa
gatttgcccttggctcaaggaatcaagtttcagtaa

DBGET integrated database retrieval system