KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106989Help
Entry
102106989         CDS       T02921                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04080  Neuroactive ligand-receptor interaction
phi05164  Influenza A
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102106989
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102106989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phi01002]
    102106989
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102106989
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102106989
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102106989
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102106989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 102106989
NCBI-ProteinID: XP_005523860
LinkDB All DBs
Position
Un
AA seq 249 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCAEHSVPYQVSLNSGYHFCGGSLISSQW
VLSAAHCYKSRIQVQLGKHNLELSESTQQFINSAKVIRHPGFNPYTLDNDIMLIKLATPA
QLNKAVQTVPLPTSCVATGTTCLISGWGNTLSNGIEYPEELQCLDAPVLSAAECSDAYPG
QITKNMMCVGFLEGGKDSCQEDSGGPVVCNGQLQGIVSWGIGCAEKGHPGVYTKVCNYIS
WIQSTVASN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttctcgcctttattggggtggctgttgccttccccacctttgct
gaagatgatgatgacaagattgtgggaggctacacctgtgcagaacactctgtgccctat
caggtgtctctgaattctggatatcacttctgtggaggttccctcatcagcagccagtgg
gtcctgtcggctgctcactgttacaaatctcgcatccaagtgcagctggggaaacacaac
ctggaactcagcgaatccactcagcagttcatcaactctgctaaagtcatccgccaccct
ggcttcaacccctacaccctggacaatgacatcatgctcatcaagctggccaccccagcc
cagctcaacaaagctgtccaaactgttcctctgcctaccagctgcgtggccaccggcacc
acctgcctgatctccggctggggcaacactctcagcaatggcattgagtacccggaagaa
ctgcagtgcctggatgctccggtcctctctgccgccgagtgctccgatgcctaccccggg
caaatcaccaagaacatgatgtgtgtaggattcctggagggaggaaaagactcctgccag
gaagattccggcggccccgtggtctgcaatggacagctccagggcattgtttcctggggt
attggatgtgctgagaagggccatcccggagtttacaccaaggtttgcaactacatctcc
tggatccaatccaccgtggcctccaactga

DBGET integrated database retrieval system