KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107430Help
Entry
102107430         CDS       T02921                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi05164  Influenza A
Brite
KEGG Orthology (KO) [BR:phi00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102107430 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phi01002]
    102107430 (TMPRSS2)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102107430 (TMPRSS2)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102107430 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Ldl_recept_a SRCR Trypsin_2 DUF3149
Motif
Other DBs
NCBI-GeneID: 102107430
NCBI-ProteinID: XP_005526672
LinkDB All DBs
Position
Un
AA seq 485 aa AA seqDB search
MASTLGPPPPYYENRGFQPEPIYAARQAAGASPYPQLFSPSAPSVPSYVPRVATHQSSRP
VAHPPRRSCAASLRKTIIILLSILIVICCAIAAFFIWYFVENHCLSSLIECGSSGVCMSP
SQWCDGVSDCPNGEDEMRCVRLFGPNFILEVYSPVSKSWYPVCQDGWNDDYGKIACKDMG
YSVDTYFHSQGVVPEVSFKSYMKLNTSAGNIDLYKKLYSSGSCASGKVVSLRCIECGLSS
KSVSIMNRIVGGSGAVLGQWPWQVSLHVQGTHVCGGSIITRHWIVTAAHCVEGRFSDPQS
WRVYAGILNQDEMLFRSGYRVQQIISHPDYDTDSKDNDVALMKLETPLSFTETVRPVCLP
NPGMMFQPNQQCWISGWGAEYQGGKTSNNLNFVAVPLIERSRCNSVYIYNGMILPTMICA
GDLAGGIDSCQGDSGGPLVTHHHSVWWLVGDTSWGTGCATPNKPGVYGNMTVFTDWIYKN
MQANR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcctctactctaggcccaccgccgccgtactacgagaacaggggcttccagccagag
cccatctacgctgctaggcaggcagcaggtgctagtccttacccacagctcttctctcca
agcgctccctccgtgccaagctacgtcccaagggttgccacccaccagtccagcaggccg
gtagcacacccacccaggagaagctgtgcagccagtctaaggaaaaccataatcatatta
ttatctatattaatagtcatttgttgtgcaattgctgctttcttcatctggtattttgta
gagaatcactgtctcagctccctgattgagtgtggctcctcaggggtgtgcatgtccccc
tcccagtggtgtgatggagtgagcgactgccccaacggggaggacgagatgcgctgtgtt
agactttttggaccaaattttatcctggaagtttattcacctgtcagcaaatcctggtat
cctgtttgccaagatggctggaatgatgattatgggaagattgcatgcaaagacatgggc
tacagcgtggatacgtatttccacagtcaaggggtagtgcctgaagtcagctttaagagc
tacatgaagctgaacacaagtgctgggaacatagacttgtacaaaaagctgtacagcagt
ggttcctgtgcctcaggaaaagtggtttctctgcgctgcatagagtgtggcctgtccagc
aagagcgtgagcatcatgaacaggatcgtgggtggcagcggggccgtgctggggcagtgg
ccgtggcaggtcagcctgcacgtgcagggcacccacgtctgcgggggctccatcatcacc
cgccactggattgtcacagcagcacactgtgtggaagggcgattttctgacccacagagc
tggagggtttacgctggcattctgaatcaggatgagatgctctttagaagtggatacaga
gtgcaacagataatttctcatccagattatgacacagactctaaagacaacgatgttgcc
cttatgaagctggagacaccactgagttttactgaaactgtgaggccagtttgtctgccc
aatccaggaatgatgttccagcctaaccagcagtgctggatatcagggtggggagcagag
taccaaggaggtaaaacatcaaataacttgaatttcgttgccgtgcctttaatagaacgt
tcgaggtgtaattctgtttatatctacaatggcatgattctgcctacaatgatctgtgct
ggagacctagcagggggaattgattcctgtcagggtgacagtggaggtcctctggtgacc
caccaccactctgtgtggtggctggttggagataccagctggggcactggctgtgccact
cccaacaaacctggagtctatgggaacatgactgtgtttacagactggatttataaaaat
atgcaggcaaacagatga

DBGET integrated database retrieval system