KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107642
Entry
102107642         CDS       T02921                                 

Gene name
SMO
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102107642 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phi04030]
    102107642 (SMO)
G protein-coupled receptors [BR:phi04030]
 Frizzled / Smoothened family
  102107642 (SMO)
SSDB
Motif
Pfam: Frizzled Dicty_CAR Fz
Other DBs
NCBI-GeneID: 102107642
NCBI-ProteinID: XP_005533134
LinkDB
Position
Un
AA seq 676 aa
MPKCEDGQVELPSQTLCQATRTPCIIVERERGWPDFLKCTTDRFPEGCPNEVQNIKFNSS
GQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEKEHREMHVYIAAFSSVTIFCTFFTLA
TFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGAREEIVCRADGTMRLGEPTSNE
TLSCVIIFVIVYYSLMSGVIWFVMLTYAWHTSFKALGTTYQPLLGKTSYFHLITWSIPFV
LTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIK
SNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEWERSFREYVLC
EANVTIATQTNKPIPDCEIKNRPSLLVEKINLFAMFGTGVSMSTWVWTKATLLIWKRTWC
RLTGQSDDQPKRIKKSKMIAKAFSKRKELLRDPGRELSFSLHTVSHDGPVAGLAFNINEP
SADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEERANLWVVEADVSPELQKRGG
HKKKRRKKKKKKEVNPDPERCLGGSSVPRLPRLPPQPCLVAFAPDVQPDAAFPGAPWAGQ
SRRAEVLHVISNPFCPESGAEESPGAGRWQHNGGSPWPPQPWPGPARTQGRRAGLAPIHS
RTNLVDAELLEPDSDF
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgcccaagtgcgaggatgggcaggtggagctgcccagccagaccctctgccaggccacc
cggactccctgcatcatcgtggagcgcgagcgcggctggcccgacttcctcaagtgcacc
accgaccgcttccccgagggctgcccgaacgaggtgcagaacatcaagttcaacagctcg
gggcagtgcgaggcaccgctggtgaggacagacaaccccaagagctggtacgaggacgtg
gagggctgcggcatccagtgccagaacccgctcttcaccgagaaggagcaccgcgagatg
cacgtctacatcgccgccttcagctccgtcaccatcttctgcaccttcttcaccctggcc
acgtttgtcgctgactggaggaactccaaccgctaccccgccgtcatcctgttctacgtc
aacgcctgcttcttcgtgggcagcatcgggtggctggcgcagttcatggacggcgcccgc
gaggagatcgtgtgccgggccgacggcaccatgaggctgggcgagcccacctccaacgag
acgctgtcctgcgtcatcatcttcgtcatcgtctactactcgctgatgtcgggtgtcatc
tggttcgtcatgctcacctacgcctggcacacctccttcaaagccctgggcaccacctac
cagccactgctgggcaagacctcctacttccacctcatcacctggtccatccccttcgtg
ctcaccgtggccatcctggccgtggcgcaggtggatggtgactctgtcagtggcatctgc
ttcgtgggctacaagaattaccgctaccgagccggcttcgtgctggcccccatcgggctg
gtgctcatcgtgggcggctatttcctcatccggggggtcatgacgctcttctccatcaag
agcaaccaccccgggctgctgagcgagaaggcggccagcaagatcaacgagaccatgctg
cgcctgggcatcttcggcttcttggccttcggcttcgtcttcatcacctttggctgccac
ttctacgacttcttcaaccaggccgagtgggagcgcagcttccgggagtacgtcctgtgc
gaggccaacgtgaccatcgccacgcagaccaacaagcccatcccggactgcgagatcaag
aaccggcccagcctcctggtggaaaagatcaacctcttcgccatgtttggcaccggtgtc
tccatgagcacctgggtctggaccaaggccaccctgctcatctggaagcgcacctggtgc
aggctgacggggcagagcgatgaccagcccaagaggatcaagaagagcaagatgatcgcc
aaggccttctccaagcgcaaggagctgctgcgcgacccaggccgggagctgtccttcagc
ctgcacaccgtgtcccacgacggccccgtggccggtttggccttcaacatcaacgagccg
tcggccgacgtgtcctcggcgtgggcccagcacgtcaccaagatggtggccaggagaggg
gcgatcctgccccaggacatctccgtgacgcccgtggcgacacctgtgccgccggaggag
agagccaacctgtgggtggtggaggccgacgtgtccccggagctgcagaagcgcggcggt
cacaagaagaagcggaggaagaagaagaagaagaaggaggtgaacccagaccctgagcgc
tgcctggggggctcctccgtccctcgcctgcctcgcctgcccccccagccctgcctggtg
gcttttgcccccgatgtccagcccgacgccgccttccccggggcgccgtgggccgggcag
agccgcagagccgaggtcttgcacgtgatcagcaaccccttctgccccgagagcggcgcc
gaggagagccccggtgccgggcgctggcagcacaacgggggctccccgtggccaccacag
ccctggccagggccagccaggactcagggccgccgggcagggctggcccccatccactct
cggaccaacctggtggacgcggagctgctggagcccgactcggacttctga

DBGET integrated database retrieval system