KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108358Help
Entry
102108358         CDS       T02921                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102108358 (DOT1L)
Enzymes [BR:phi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102108358 (DOT1L)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102108358 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 102108358
NCBI-ProteinID: XP_014115552
LinkDB All DBs
Position
Un
AA seq 1722 aa AA seqDB search
MGERLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKIQ
ENKDSGAEEEKAAANSVKKPSPSKARKKKLSKKGRKMAGRKRGRPKKMNTASTERKTKKN
QTALELLHAQTVSQTSSSSPQDAYKSPHSPYYQLPPKVQRHSSNQLLVTPTPPALQKLLD
SFKIQYMQFMAYMKTPQYKASLQQLLEQEKEKNAQLMGTAQQLFTHCQAQKEEIKRLFQQ
KLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKL
DWSTLSLENLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELLQLKSYTPSEEPL
SVQLHSKSHLSRDPEAEHGRFQLELECSKFPMPHINGMSPELSMNGHATPYELQHAFSRS
SSKQNTPQYPNSHLDQDIVPCTPNHSRQKADKVTSLSLPDYTRFSPAKIALRRHLNQDHG
VNGKATANEIQRAEHVKENGLTYPSPGIANGIKLSPQETRPSSPAALPSAGEKVLRERTS
VSNGETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQSRDSSTLEK
QIGASSHNGISNAAGNKPLALATSGFSYSSGSVAVNGNLTNSPAHLNHSVDQAALDDSGS
LFNSVGSRSSTPQHPLLMMRNSGQNSPAQQHSSPRLSGPAPSLAGGLQSAEAQKIFAEGT
KGDLQSDAAFSDPENEAKRRIIFTISPNTGHVKQSPSSKHSPVPAGARPAGGQAHAQDGK
KRGRRKRSSTGNPSGNAAVSPKRKSLPSVAGLFTQPSGSPLNINSMVNNINQPLEITAIS
SPENSLKNSPVPYQDNDQPPVLKKEKPLIQSNGVHYSPLTSDDEQGSEDEHNSSRIERKI
ATISLESKSPQKTVENGGSLSGRKQAQSNENMNSSKWKSTFSPISDINLTKTTDSPLQAV
SALSQNSLFAFRPPSEDGLAMDTKVPGHPRKSLAVPSDGLSPGTNPPNGFTYNGGLSSEL
GLHGFMDSAALPHKAPDGTASTCSLGFPSQRGKDLGVSDTNLFLNKRQLEGLGTKGEELS
RPGVKGKELSELSARVGGSAEKNSVQHNGKVGKGRDRDVEFKNGHNLFISAAVSSGGLLN
GKSLSTAVSSAGNPAPSVPTHHPFLNTLTTGSQFPLGPMALQANLNSVTNSSVLQSLFNS
MPAAASLVHVSSAATRLTNSHTMGNFSPGVTGGTVGGIFNHAVPSASSPHQFGASFSSSA
VSSSTVLSLNPLQAVASTSSSSFPPSSSNLVTSSETRPAQHLNRAPVQSVFHPPPPPPNV
SLPPPPPLLASNSEPALLQNLPSIPPGETFLPSSSAPVQSNSSLSIKLASLQHKPSRPSF
TVHHPPLPRVLPQPNAAGTAAMWVTLGMQPPYASHLSGVKPR
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaggctggagctgcggctgaagtcgcccgtgggagccgagcccgccgtgtac
ccctggccgctgcccgtctacgacaaacaccatgatgctgctcatgaaattattgagaca
attcggtgggtctgtgaagaaatcccagatctcaagcttgccatggaaaactatgtttta
attgactatgatacaaaaagctttgagagcatgcagagactgtgtgacaaatacaaccga
gccatcgacagcatccaccagttgtggaaggggacgacgcagcccatgaagctgaacacg
cgtccctccaacgggctcctgaggcacatcctgcagcaggtctacaaccactcggtcaca
gaccctgagaaactcaacaactacgagcccttctcccctgaggtctacggagaaacttcc
tttgacttggtggcccaaatgatcgatgagattaaaatgacagaggatgatttgttcgtt
gacttgggcagtggtgtggggcaggtggtgcttcaagtggctgcagccacaaactgcaaa
catcactacggagtggagaaagctgatattccagccaagtacgccgagacgatggacaga
gagttcagaaaatggatgaaatggtatgggaagaaacatgcagaatacacactggaaaga
ggtgacttcctctcagaagaatggagagagaggattgcaaacacaagtgttatttttgtc
aataactttgccttcgggcctgaggtggatcaccagctgaaggagcgctttgcgaacatg
aaggaaggtgggagaattgtgtcctcaaaaccttttgcacctctaaattttagaattaac
agtcgaaacttgagtgatattggcactatcatgagggttgtggagctgtcaccactgaag
ggctccgtgtcctggacggggaagccagtctcctactacctgcacacgattgacagaacc
atacttgaaaactatttttctagtctcaaaaatccaaaactcagggaggaacaagaggca
gctagacgtcgtcaacaaagagaaaacaaaagtaacacaacgactccaacgaagatccaa
gaaaacaaggattctggtgctgaagaagaaaaagctgcagcaaattctgtaaaaaagcca
tctccctccaaggcccggaagaaaaagctgagtaagaaaggcaggaaaatggcagggagg
aaacgaggccgccccaagaaaatgaacacagcaagtactgaacgtaagaccaagaagaac
caaactgcactagaacttctgcatgctcagactgtctcccagacatcttcatcctctcct
caggatgcctacaagtcacctcatagcccatattaccaactacctcctaaagtgcaacgg
cattcgtccaaccagctcctggtgacacccaccccccctgcactacagaagctgctagac
tcatttaagatccagtacatgcagttcatggcatacatgaaaactcctcagtacaaagca
agtctgcaacagttactggagcaggaaaaggagaagaatgctcagctgatggggacagcc
cagcagttattcacccactgccaggcccagaaagaggaaatcaaacgcctgtttcagcag
aagctcgatgagttgggggttaaagctctgacatacaacgacctgatccaggctcagaag
gaaatctctgctcacaaccagcagctgaaagaacagacaaaacagctggagaaggacaac
agtgaactcaggaaccagagcttgcagctgctgaaggctcggtgtgaagaactgaagctg
gattggtcaacgctgtcactggagaacttgctgaaagagaagcaggccttgaagaatcag
atttctgagaagcaaaagcactgtttggaactgcagatcagcattgtggaacttgaaaag
agtcagcggcagcaggagctgctgcagctcaagtcctacacaccctcagaggagcccctg
tcagtgcagctgcacagcaaaagccacctgagccgtgaccccgaggctgagcacggcagg
ttccagctggagctggagtgctccaagttccccatgccccacatcaatggcatgagcccc
gagctgtccatgaacggccacgccaccccctacgagctccagcacgccttcagccggtcc
tcgtccaagcagaacaccccccagtaccccaactcccacctggaccaagacattgtgccc
tgcacccccaaccacagcaggcagaaggcagacaaggtgacgagcctgtccctccctgat
tacaccaggttttcccctgctaaaatcgccctgcggagacacttgaatcaggaccacgga
gtcaatggaaaagcaacagctaatgagatacagagagctgagcatgtcaaagagaatggc
cttacatatccaagccctggaattgcaaatggcataaagctgagtcctcaggaaactcgg
ccctcctcccccgcggccttacccagtgcaggagagaaggttttgagagagagaacctct
gtgagtaatggagaaactatcaccagcctccctatcagtattcctctgagcacagtgcag
cccaataaactccctgttagtatccctctggccagcgtagtcctacctagccgtgttgag
aaggtgagaagcacacccagcccagttcaccagagtagagactcatcgacacttgaaaag
cagattggtgctagttctcataatggcataagcaatgctgctggaaacaagcctctggct
ttggctacctcaggtttttcttactcttctggctccgtggcagtcaatggaaatcttaca
aacagcccagcccatcttaaccatagtgttgatcaggcagctctggacgactctgggagt
ctctttaactctgtagggtctcggagttccactccacaacatcctttgctaatgatgagg
aactctgggcagaactcccctgctcagcagcactcgagcccccgcttaagtggcccggcc
ccaagcctggcagggggactgcagagtgcagaggctcagaagatctttgccgaaggaaca
aagggggacctgcagtctgatgcagcgttttcagatcctgagaacgaggccaagaggaga
atcatctttacaatctctcctaatacaggacatgtaaaacaatccccttccagcaagcac
agccccgtgcccgccggcgcccggccagcgggcggccaggcccacgcgcaggacgggaag
aagcgcggccggcggaagagatcctccacggggaatcccagcgggaacgccgccgtctcc
ccgaaacgcaaatccctgccctcggtggccgggctctttacgcagccctcggggtcgccg
ctcaatatcaactccatggtcaataacattaaccagcccttagaaataacagccatttcc
tctcctgaaaactccctgaagaactctcctgttccttaccaggacaatgaccagccccca
gtgctgaaaaaggagaagcccctcattcagagcaacggtgtccattactcccccctgaca
tcggatgacgagcagggctctgaggatgagcacaatagcagcagaattgaaaggaaaatt
gcaacaatatcattggaaagcaaatctccacagaagactgttgaaaatggtggcagctta
tcggggaggaaacaagcacaaagcaacgagaacatgaacagcagcaaatggaaatcgact
ttctcaccgatatctgacatcaacctgaccaaaaccacagacagccccttgcaggcggtg
tcagccctgagccagaactccctgtttgccttcaggccgccctccgaggacgggctggcc
atggacaccaaggtcccaggacaccccaggaagagcctggcagtgccctcggatgggctg
agccctggcacaaacccccccaatggcttcacctacaacgggggcctgtcctccgagctg
ggcctgcacggcttcatggacagcgccgctcttccacacaaagctccggacgggacggct
tccacctgctccctgggcttcccctcgcagcgaggcaaggacctgggggtgtcagacacc
aaccttttcctgaacaagaggcagctggaaggtctgggcaccaagggagaagagctgagc
cggccgggggtgaagggcaaagagctcagtgagctgagcgcccgagtgggggggtctgcg
gagaaaaactctgtgcagcacaacggaaaggtcggcaagggaagggaccgagacgtggag
tttaaaaacggccacaaccttttcatttctgctgctgtttcgtctggtggccttctgaat
ggtaaaagcctttctactgctgtttcctcagcagggaacccagcgccgtctgtcccgacg
caccatcctttcctcaacactctgaccactggatcgcagttccccctcggccccatggcc
ttgcaagcaaacctcaactcggtgacaaattcctcagtattgcagtccttatttaattca
atgccagctgctgccagtctggtccacgtgtcatcagctgcaaccagactgactaattct
cacactatggggaacttctctcctggggttacaggtggaacagttggaggtatttttaac
catgcggtgccttctgcctcctctcctcatcaatttggagccagtttcagcagcagtgct
gtctctagcagcaccgtgctaagcttaaaccctctgcaggctgttgccagcacctcatcc
tcatccttcccaccctcttcctctaatttagtaacatctagtgagactagacctgctcag
cacctcaacagagcgccagtgcaatctgtcttccatccccctccgccccctcctaacgtg
tccttgcctcctcctcctcctttactcgcttctaactccgagcctgctctcctgcagaac
ctgccctccatcccccccggcgagacgttcctgccctcctcctctgctcctgtccagtct
aactcttctttgtctattaaactggcttctctccagcacaaaccctcccgtccctccttt
acagtccatcacccgcccctgccccgcgtgctcccgcagcccaacgccgctggcacggcc
gctatgtgggtgacccttggcatgcagcctccttatgcttcgcacctttcgggggttaag
ccacgataa

DBGET integrated database retrieval system