KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108670Help
Entry
102108670         CDS       T02921                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00020  Citrate cycle (TCA cycle)
phi00190  Oxidative phosphorylation
phi01100  Metabolic pathways
phi01200  Carbon metabolism
Module
phi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102108670 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102108670 (SDHA)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102108670 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102108670
NCBI-ProteinID: XP_005517419
LinkDB All DBs
Position
Un
AA seq 665 aa AA seqDB search
MAAAAVRGLAKRWLRPAAASRAWPAACQAPARNLHFTVYGKKNASTKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQ
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIANTCKPGE
PVPPIKPNAGEESVANLDKLRFADGSIRTSEVRLSMQKAMQNHAAVFRTGSVLQEGCEKL
SQIYGDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKL
RVDEFDYSKPLQGQQKKPFEEHWRKHTLSYVDIPTGKVTLKYRPVIDKTLNEEDCQTVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggctgtgcgggggctggccaagcgctggctgcgaccggccgcggcttcc
cgggcgtggccagcagcatgccaggctcctgcacggaacttacacttcacagtctatgga
aagaaaaatgcctccacgaaggtgtctgactcgatttctacacaatacccagtagtggac
catgaattcgatgcagttgttgtgggtgcaggaggagcaggtctgcgggctgcctttggt
ttgtcagaagctgggtttaacacagcctgtgttaccaagctgttccccacccgctctcat
acagttgctgcacagggagggatcaatgctgctctggggaacatggaagatgataattgg
aggtggcatttttatgacacagtgaaagggtcggactggctgggagaccaggatgccata
cactacatgactgagcaagccccagctgcggtgatagagctggaaaattatgggatgcca
ttcagcagaactgaagaaggaaaaatctatcagcgtgcatttggtggacagagtcttcag
tttggaaaaggaggacaggcccacagatgctgttgtgttgcagacaggactggacattca
ctcttacatactttgtatggcaggtctctacgatatgatacaagctactttgttgaatat
tttgccttggacctacttatggagaatggagaatgccgtggagttattgccctctgcatt
gaagatggaaccatacatcgttttagagcaaagaacactgtcattgccactggtgggtac
ggccgcacttacttcagctgcacatctgctcataccagtactggtgatggcacggcgatg
gtcacacgagctgggctcccttgccaggacttagaatttgtgcagtttcaccctacaggt
atctatggggctggctgccttatcacagaaggatgtcgtggagagggaggtattctgatc
aacagccaaggtgaaagattcatggagagatatgcacctgttgccaaggatctggcttcc
agggatgtagtgtctcgttctatgaccatagaaatccgtgaaggaaggggttgtggtcct
gaaaaagatcatgtgtacttgcagttgcaccacttgccaccacagcagctggcaacccgt
ctcccagggatttctgaaacagccatgatattcgctggagttgatgtcactaaagagcct
atccctgtcctgcctactgtgcattataatatgggaggtattcctactaactacaaagga
caggtgatcacacacgtcaatggtgaggataaggtggtgcctgggttatacgcctgcggg
gaagcggcctctgcatctgtccatggtgcaaatagacttggagcaaactctcttctggat
ttggtagtctttggtcgtgcttgtgccctgactattgcaaatacatgcaagcctggagag
ccagttcccccaattaaaccaaatgctggtgaagagtcagttgctaatcttgacaagtta
aggtttgctgatggaagcataaggacttcagaagtgcgccttagcatgcagaaggcaatg
caaaaccatgctgctgtatttcgtactggttctgtactccaagaaggctgtgagaaactt
agccaaatttatggtgatctggctcatctaaagacttttgacagaggtattgtttggaac
actgacttggtggagacccttgaactgcagaacctgatgctttgtgctctacaaaccatt
tatggtgctgaggctcgcaaagagtcccggggtgcccatgccagagaggattataagtta
cgggtagatgagtttgactactctaagccactccaaggccaacagaagaagccatttgag
gagcactggagaaagcacaccctgtcatatgtggatattccaactgggaaggttaccttg
aagtacagaccagtgatcgacaaaaccttgaatgaggaagattgccagactgtcccacca
gcgatccgctcatactag

DBGET integrated database retrieval system