KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108753
Entry
102108753         CDS       T02921                                 

Gene name
GRK3, ADRBK2
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04144  Endocytosis
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102108753 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102108753 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102108753 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102108753 (GRK3)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     102108753 (GRK3)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   102108753 (GRK3)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102108753 (GRK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 102108753
NCBI-ProteinID: XP_005524386
LinkDB
Position
Un
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKSTPAARASKKITLPEPSIRSVMQKYLEERGELTFDKIFH
QRIGFLLFKDYCMNEIDEAVPQLKFYEEIKEYEKLDSEEERLSRSRQIYDTYIMKELLSC
SHPFSKQAVDHVQTHLAKKQVPASLFQPYIEEICDSLRGKIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDSFSPE
LKSLLEGLLQRDVSKRLGCQGRSAQEVKEHPFFKGIDWQQVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYDAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQRLLRR
APKFLNKSRSTVVELSKPPLSHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgatgtcagctacctgatggcgatggagaagagc
aagagcaccccggcggccagggccagcaagaagatcaccctgcccgagcccagtatccgc
agtgttatgcagaaatacctcgaagaaaggggtgaattaaccttcgacaagatctttcat
cagagaattggatttctgctctttaaagactattgcatgaatgagatcgatgaagctgtc
cctcagctgaagttctatgaagagatcaaggagtacgagaagctggactcagaggaggag
cggctgtcgcggagccggcagatctacgacacctacatcatgaaggagctgctctcctgt
tcccaccctttctcaaagcaagctgtagatcatgtacaaacacatttagccaagaaacaa
gtgccagccagccttttccagccatatatagaagaaatttgtgatagtctccgaggaaaa
atatttcaaaaatttatggaaagtgacaagtttactagattttgtcaatggaaaaatgta
gagctaaatattcatctgactatgaatgattttagtgtacatagaataataggaagaggg
ggatttggtgaagtgtacggctgcagaaaagcagacactggaaaaatgtatgcaatgaaa
tgtttagataagaagagaatcaaaatgaagcaaggagaaacattagccttaaatgaaaga
attatgctgtctcttgtcagtacaggagactgtccttttatagtctgtatgacctatgcc
ttccacacccctgacaagctctgcttcattctggacctcatgaatggaggagatttgcac
taccacctctcccagcatggagtgttttctgaaaaagagatgaggttttatgctactgaa
atcatcctggggttagagcacatgcacaatcgcttcgtggtgtacagagacctgaagcct
gcaaatatcctgctggatgaacacgggcacgtgaggatatcagaccttgggctggcttgt
gacttttccaaaaagaagccacatgccagtgtaggaacccacgggtacatggcccccgag
gtgctgcagaagggcacagcctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctgctgagggggcacagccctttcaggcagcacaaaaccaaagataagcac
gagatcgaccggatgacgctcaccgtgaatgtggagctcccggattccttttctcccgag
ctgaagtcccttctggaagggctcctgcagcgggatgtgagcaagaggcttggatgccaa
ggaagaagcgcacaagaagtaaaggaacatcctttcttcaaaggcattgattggcagcaa
gtctatttacagaagtaccctcccccactgattcctccccggggagaagtcaatgcagca
gatgcttttgatattggctcgtttgatgaagaggacactaaaggcattaagttgcttgat
agtgaccaggagttatataagaacttccctctggtaatatcggagcgttggcagcaagaa
gtagcagaaactgtttatgatgcagtaaatgcagacacagataaaattgaggccagaaaa
agggctaaaaataagcagcttggccacgaggaagattatgccctggggaaggactgtatc
atgcacggatacatgctcaagctggggaaccccttcctgactcagtggcagcggcgttac
ttttacctcttccccaaccggctggagtggcgaggagaaggagagtcccggcaaaacctg
ctgacaatggaacaaattgtatctgttgaagaaacacaaattaaagataagaaatgcatc
ttactgcgaattaaaggaggaaaacagtttgtcctacagtgtgagagcgaccccgagttt
gttcagtggaaaaaagagctgacagaggctttcaccgaggcccagaggttgctgcgccgg
gctccaaagttcctcaataaatcccgctccacagtcgtagagctctcgaagcccccgctc
agccacaggaacagcaacgggctgtag

KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114443
Entry
102114443         CDS       T02921                                 

Gene name
GRK2, ADRBK1
Definition
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04144  Endocytosis
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102114443 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102114443 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102114443 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102114443 (GRK2)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     102114443 (GRK2)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   102114443 (GRK2)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102114443 (GRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 102114443
NCBI-ProteinID: XP_005528999
LinkDB
Position
Un
AA seq 688 aa
MADLEAVLADVSYLMAMEKSRAAPAARASKRIVLPEPSIRSVMQKYLEDRGEVTFDKIFT
QKIGYLLFRDFAFNQAEEAKPLMEFYEEIKKYEKLDSEEERATRSRHIFDHYIMKELLAC
SHPFSKSATEHVQSHLSKKQVPPDLFQPYIEEICQNLRGGIFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEAEMRFYAAE
IILGLEHMHSRFVVYRDLKPANILLDEFGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCMGRGAQEVKEEPFFKGLDWQMVFLQKYPPPLVPPRGEVNAA
DAFDIGSFDEEDTKGIKLLESDQELYRNFPLTISERWQQEVTETVFDTVNADTDKLEARK
KAKNKQLGHEEEYAMGKDCIMHGYMAKLGNPFLTQWQRRYFYLFPNRLEWRGEGESPQSL
LTMEEIDSVEETQVKERKCILLRIRGGKQFVLQCDSDPELVQWRKELRDAQRQAQQLLQR
VPRMQNKPRSPVVELNKVPFIQRSPNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggcggacgtgagttacctgatggccatggagaagagc
cgcgccgcgcccgccgcccgcgccagcaagaggatcgtcctgcccgagcccagcatccgc
agtgtcatgcagaagtacctggaggaccggggagaggtgacatttgacaagatcttcaca
cagaagattggctacctgcttttccgggattttgccttcaaccaggctgaggaggccaag
cccctgatggaattttacgaggagatcaagaagtatgagaagctggactcagaggaggag
cgagccacccgcagtcgccacatctttgaccattatatcatgaaggagctgctggcctgc
tcccaccccttctccaagagcgccacggagcacgtccagagccacctgagcaagaagcag
gtgcccccagatctcttccagccctacatcgaggagatctgccagaacctgcgtgggggc
atcttccagaaattcattgagagtgacaagttcacgcggttctgccagtggaagaacgta
gagctgaacatccatctcaccatgaacgactttagcgtccaccgaatcatcggccgtggc
ggcttcggggaggtctatggctgccggaaagcggacacgggcaaaatgtacgccatgaag
tgcttggacaagaagcgcatcaagatgaagcagggcgagacgctggccctcaacgagcgc
atcatgttgtccctcgtcagcactggggactgcccgttcatcgtgtgcatgtcctacgcc
ttccacactcccgacaagctcagcttcatcctcgacctcatgaatgggggggacctgcac
tatcacctgtcccagcacggcgtcttctcggaggcagagatgaggttctacgcggccgag
atcatcctgggcctggagcacatgcacagccgctttgtggtgtaccgtgacctcaagccg
gcaaacatcctcctggacgagtttggccatgtccgcatctccgacctgggcctggcctgc
gacttctccaagaagaagccccacgccagcgtgggcacccacgggtacatggcgccggag
gtgctgcagaagggggtggcctacgacagcagtgccgactggttctcgctgggctgcatg
ctcttcaagctgctccgggggcacagcccattccggcagcacaagacgaaggacaagcac
gagattgaccggatgacgctcaccatggctgtggagctgccagactccttctccccagag
ctgcgctccctgctcgaggggctgctgcagcgggatgtcaaccggcgcctgggctgcatg
gggcgaggggcgcaggaggtgaaggaagagcccttcttcaagggcctggactggcagatg
gtgttcctgcagaagtacccgccgcccctcgtcccaccccgcggtgaggtgaacgcggct
gacgcctttgacatcggctcctttgatgaggaggacaccaagggcatcaagctgctggag
agcgaccaggagctgtaccgcaacttcccgctcaccatctcggagcgctggcagcaggag
gtcaccgagaccgtcttcgacactgtcaacgccgacacggacaagctggaggctcgcaag
aaggccaagaacaagcagctgggccatgaggaggagtacgccatgggcaaggactgcatc
atgcacggctacatggccaagctgggcaaccccttcctgacgcagtggcagcgccgctac
ttctacctcttccccaaccgcctggagtggcgcggggagggcgagtcgccgcagtccctg
ctcacaatggaggagatcgactcggtggaggagacacaggtgaaggagcgcaagtgcatc
ctgctccgcatccgcgggggcaagcagttcgtgctgcagtgcgatagcgaccccgagttg
gtgcagtggcggaaggagctgcgggacgcacaacgccaggcgcagcagctgctgcagagg
gtgccccgcatgcagaacaagccccgctcgcccgtggtggagctcaacaaagtgccgttc
atccagcgctcccccaacgggctctga

DBGET integrated database retrieval system