KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108817
Entry
102108817         CDS       T02921                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00220  Arginine biosynthesis
phi00330  Arginine and proline metabolism
phi01100  Metabolic pathways
phi04020  Calcium signaling pathway
phi04146  Peroxisome
phi04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102108817 (NOS2)
   00330 Arginine and proline metabolism
    102108817 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102108817 (NOS2)
   04020 Calcium signaling pathway
    102108817 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102108817 (NOS2)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102108817 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102108817
NCBI-ProteinID: XP_014110366
LinkDB
Position
Un
AA seq 1024 aa
MTPKGLVRGTRDGPVPLEDLLPQAVDFLKQYYSSFKEPKIKEQLGRLETVTKEIETTGTY
HLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIQYATNNGN
IRSAITVFPQRTDGQHDFRVWNSQLIRYAGYQMPDGSVLGDPATVEFTQLCTELGWKPKY
GRFDVLPLVLQANGRDPEIFELPPEIVLQVPMEHPKYEWFRELDLKWYALPAVASMLLEV
GGLEFTACPFNGWYMGTEIGVRDFCDAQRYNILKEVGRRMGLETNKLSSLWKDRAVVEIN
VAVLHSFQKQNVTIMDHHSAAESFLKYMQSEYRARGGCPADWVWIVPPMSGSITPVFHQE
MLNYVLTPFYYYQVDAWKTHVWHDETRRPRKKEIRFSILAKAVLFASSLMQGAVATRAKV
TVIYATETGKSETLANNLCSLFSCAFSTKILCMDEYNICDLEKETLLLVVTSTFGNGDSP
GNGKTLKDSLLRLKVLRNKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASQLTPVGEG
DELNGQEEAFRSWAISAFKTACDIFNIRGRHSIQLPEIYSSEESWDPTNYRLVHDSQPMD
LAKALASIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLHCETNQEVHYLPGEHIGIFPGN
QAELVHGIIARVKDAPPADQTIRLETCIDGGYWTSHKKVPACTLPEALTYLLDITTPPSQ
QLLKKLSQLVTAEGDKQRLEVLCQVKEYNKWKFYNSPNILEVLEEFPSAEISTAFLLTQL
PFLKPRYYSVSSSCDMTAREIHLTVAVVNYRTRDGKGPLHHGVCSTWLNTIELNETVPCF
IRSANDFHLPEEPARPCILIGSGTGIAPFRSFWLQRLYDLEHRGLRGGDMTLLFGCRQPD
LDHIYREETEEMKRKGVLRDVYTAYSRLPGQDKVYVQDILQRQLEARVCEVLQVQQGHIY
VCGDVRMARDVARALRALLARGLRLSQQQANEYFQQLKSQKRYHEDIFGAVFPHEVKRAL
QPSS
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgaccccaaagggcctggtgagaggtaccagagatgggccagttccactggaagatctt
ttacctcaggcagtagacttcctcaagcagtactacagttcctttaaagagccaaaaatc
aaagagcagctgggccggctggaaacagtgaccaaggagatagaaacaacaggaacctac
cacctgacaaaggatgagctgatctttgctgccaagcaggcctggaggaacgcgcccagg
tgcattggaagaatccagtggtccaatctgcaggtgtttgatgcacgggactgtaaaaca
gccaaggaaatgtttgagcatatctgtcgtcatattcagtatgccacaaataatggcaat
ataaggtcagccatcacggtgttcccgcagaggacggacgggcagcacgatttccgtgtg
tggaacagccagctgatccgctacgctggctaccaaatgccagatggctctgtccttgga
gaccctgccactgtggagttcactcagttgtgcactgagcttgggtggaagccgaaatat
ggccgctttgatgtacttccacttgttctccaagcaaatggccgagacccagaaatattt
gaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtacgagtggttt
agggagctggacctgaagtggtatgcactgcctgctgtggccagcatgctgctggaggtg
ggagggctggagttcaccgcctgtcccttcaatggctggtacatggggacagagattgga
gtgcgggacttttgtgatgctcagcgctacaacatcctgaaggaggtggggaggagaatg
ggactggaaacaaacaaactctcatcattatggaaggaccgagctgttgtagagatcaat
gtggctgtgcttcacagcttccagaaacagaatgtaaccatcatggatcaccactcggcc
gccgagtccttcctgaagtacatgcagagcgagtaccgtgcgcggggcggctgcccggca
gactgggtgtggattgtgcctcccatgtcaggcagcataacccctgtgtttcaccaagag
atgctgaactatgtcctcactcccttctattactaccaggtggatgcatggaaaacacat
gtgtggcatgatgagacccgcaggccaaggaaaaaagaaataaggtttagcatcttggca
aaggctgtgctctttgcatcctcactcatgcaaggagcagtggccaccagggccaaggtc
actgtgatctatgccacagagacgggcaagtcagagacgctcgccaataacctgtgcagc
ctgttcagctgtgccttcagcactaagattctgtgcatggatgagtacaatatttgtgac
ctggaaaaagaaacacttcttttagtggttactagcacttttggaaatggagattctcca
ggtaacggaaagaccttgaaggactccttgctcagactgaaagtgctgagaaataaaatt
agatatgctgtgtttggtctgggatccagcatgtacccagagttctgtgcctttgctcat
gccattgaccaaaaactggcccaacttggggcttcccagctcactccagtgggtgaaggg
gatgaactcaatgggcaagaagaagctttccgtagctgggcaatcagtgctttcaagact
gcctgtgacatttttaacatccgtgggagacacagtattcagttgcctgagatctacagc
tctgaggaaagctgggaccctactaattacaggctagtgcacgactcccagcccatggac
ctggctaaagctcttgcaagcattcatgccaaggatgtaattcccatgaagctgaaattc
aggcagaatcttcaaagtttgaagtccagtcgtgttaccattctggttaaacttcactgt
gagactaaccaggaagtgcattaccttcctggggagcacatcgggatttttccaggcaac
caggcagagttagtccatggcattattgcacgagtcaaggatgcccctccagctgaccag
actatcaggcttgaaacctgcattgatggtggatactggacaagtcataaaaaggttcca
gcctgcacactacctgaggctttgacatacttgcttgatatcactactccaccctcccaa
caactgctaaaaaaactctcccagctggtgacagcagaaggagacaaacagaggctggaa
gtgttgtgtcaggtgaaagaatacaataaatggaagttttacaacagcccgaacatcctg
gaggtcctggaggaattcccctctgctgagatctccacagctttcctgctgactcagctg
ccatttctgaagcccaggtactattctgtcagctcatcctgtgacatgacagccagagag
attcatctgacagttgcagttgtaaactacaggacaagagatggaaaagggcctttgcac
catggagtctgcagcacgtggctgaacacaatagagctcaatgaaaccgttccctgcttc
atccgcagtgctaatgacttccacctgccggaggagcccgccaggccctgcattctgatc
ggctcgggcaccgggatcgctcccttcaggagcttctggctgcagcgcctctatgacctg
gagcacagagggctcaggggaggggacatgacgctgctcttcggctgccggcagccagac
ctggatcacatctacagagaggaaactgaggaaatgaagaggaagggagtcctgagagat
gtctacacagcttattccagactgcctggccaagacaaagtctatgtgcaggacatcctg
cagaggcagctggaggcccgcgtgtgcgaggtgctgcaggtgcagcagggccacatctac
gtgtgcggggacgtgcgcatggcgcgggacgtggcgcgggcgctgcgggcgctgctcgcc
cggggcctgcgcctcagccagcagcaggcaaacgagtacttccagcagctcaagagccaa
aagcgataccatgaagatatatttggggctgtgttcccacatgaagtcaaaagagctttg
caacccagcagctga

DBGET integrated database retrieval system