KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109115
Entry
102109115         CDS       T02921                                 

Definition
(RefSeq) chromosome unknown open reading frame, human C16orf52
  KO
K23663  modulator of smoothened protein
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102109115
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB
Other DBs
NCBI-GeneID: 102109115
NCBI-ProteinID: XP_005523003
LinkDB
Position
Un
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASLANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggacaaactgaccatcatctcaggatgcctcttcctggctgccgacatcttcgccatc
gccagcctggcgaacccggactggatcaacaccggcgagtccgcgggtgctctcacagtt
ggccttgtgcgacagtgtcaaaccatccatggacgtgacaggacctgtattcctccacgg
ctgcctcctgagtgggtcactacgttatttttcatcataatgggaatcatttcactaact
gtcacatgtggtttgctggtggcttcccactggcgaagagaagctactaaatatgcccgc
tggatagctttcactggaatgattctattctgtatggcagccctaatatttccaatagga
ttttacatcaatgaagttggaggtcaaccatataaattacccaataacacagtggttggg
tcttcgtatgtactgtttgtcttatccattttctttacaatagtgggacttctatttgct
ggcaaagtttgtttacctggctga

DBGET integrated database retrieval system