KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109661Help
Entry
102109661         CDS       T02921                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102109661 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102109661
NCBI-ProteinID: XP_005525369
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MSETTSINEENKLPLNGRRAIPPNYSNDEENEVPEMEAFGLIPRGFNPRDYLRVVDIYMF
KEPHEINKQEHHTDKYYNPKLIVRRGQAFQIQIDFNRPYKPETDQFWLEFLMGRYPQQNK
GTYIPILVGNVLKPGQWGAKIIHRENNSIRLSIMSSPTCIIGKFRLYVAVLTPFGILRTR
RNSATDIYILFNPWCQLDAVYLDDEKEREEYVLNDVGIVFHGNVEDVKSRSWSYGQFEEN
ILDACLFLMDKAELELSGRGNPVKICRIASAVINSRDDDGVIAGSWTNSYDYGVPPSAWT
GSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLRLDFF
LDDEGKVDTKLTKDSVWNYHCWNEAWMTRPDLPIGFGGWQVVDGTPQETSDGMYRCGPAS
VQAIKHGHVCFQFDAPFVYAEVNGDIFYTRMEKNGTQVVENVDTTRIGQLIVTKEVGGDG
MMDITEEYKFREGSDEERLALETAVMYGVKKQSIQDTTYQPQTDVDMDFQAQKAVLGHDF
KVTITFRNKSRNSYTATTYLSGNTVFYTGVTKSEFKKHSFSVKLEPSSSSSFDIVIKSSE
YMSDLLEQASFHFFVTARINETGKILAVQKAIMLEIPTLRIKTKGELVAGKETSVIVEFT
NPLKQNLENVTLRLEGPGVLRTIKKQFGRIPMNSTLTWEVKFIPMRPGLRKLIASLNSDA
LRHVYGELSVQIQKP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaacgagcatcaacgaggagaataaacttcctctgaatgggagaagagct
atcccaccaaactactccaatgatgaagaaaatgaggttcctgagatggaagcttttgga
ttgatacctagaggatttaatcctagagattacctgcgtgttgtggatatttatatgttc
aaggagcctcacgagatcaacaagcaggagcaccacactgacaagtactacaaccccaag
ctgatagtgcgtcggggacaggctttccaaatccagatagacttcaaccgaccctacaag
ccagagacagaccaattttggctggagtttttgatgggtcgttacccacagcaaaacaaa
ggcacctacatcccaatactagtaggcaatgtgctaaaacctggtcagtggggagccaag
attatccacagagaaaacaactccattcgactgtccatcatgtcctcccccacctgtatc
attgggaagtttcgcttgtatgttgctgtcttgactcccttcggcatccttcggacacgc
aggaattcagcgaccgacatttacatcttgttcaatccctggtgccagttggatgctgtg
tacctggatgatgagaaagaaagagaagaatatgtcctgaatgatgttggtattgtattc
catggaaacgttgaagatgtaaagtcaagaagctggagttacgggcagtttgaagaaaac
attctggatgcttgcctgttcctgatggacaaggcagaactggagctctctggtcgtgga
aacccagtcaaaatctgccgtattgcctcagcagtgattaactccagggatgatgatggt
gtgattgctggatcctggaccaatagttatgattatggtgttccaccttcagcctggacg
ggaagtgtggacattctcttggagtattacagttctaagcagcctgtccgatatggccag
tgctgggtcttcgctggtgtcttcaacacgtttctgagatgcttggggatacctgcaaga
ctcattaccaactattcttctgcccatgataacaatgccaatttacggttggacttcttt
ttggatgatgaaggaaaagtggacaccaaacttacaaaagattctgtctggaattatcat
tgctggaacgaagcttggatgaccagacctgaccttcccattggttttggaggatggcag
gttgttgatgggacacctcaagaaaccagtgatggtatgtacaggtgtggtccagcctca
gttcaagccattaaacatggtcacgtttgtttccaatttgatgctccttttgtctatgct
gaggtgaatggtgacattttttacacaagaatggagaaaaatggaactcaagtggtagaa
aacgttgacacaacccgtattgggcagttgattgtgaccaaggaagttggaggtgatgga
atgatggacattactgaggagtacaagttccgagaaggctcagatgaggagagactggct
cttgagactgctgtgatgtatggtgttaaaaagcaaagtatccaagataccacgtaccag
ccacagacagatgttgacatggacttccaggcacaaaaggcagtccttggccatgacttt
aaagtcactataactttcaggaacaaaagtcgcaactcctacactgcaactacctacctt
tcaggcaacacagtgttttatacaggagtcacaaaaagtgaattcaagaagcactctttc
agtgtaaaactggaaccctcttcatccagctcttttgacattgtgatcaaatcgagtgag
tacatgagtgacctgctggagcaagcctcctttcatttctttgtcactgcgcggatcaat
gaaacggggaagattctggctgtgcagaaggcgataatgctggaaattcccaccctgcgg
atcaagaccaaaggcgaactggtagctggtaaggaaacatctgtgattgtggaattcacc
aatcctctgaaacaaaacctggagaacgtcacgctccgccttgagggacctggcgtgctg
agaacaataaaaaagcagtttgggagaatcccgatgaactctacattgacctgggaagta
aaatttatcccaatgcgaccaggcttacgaaagctgattgcaagcctgaattctgatgct
ttgaggcatgtgtatggtgagctgagtgtccagattcagaaaccatga

DBGET integrated database retrieval system