KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109794Help
Entry
102109794         CDS       T02921                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00590  Arachidonic acid metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102109794 (PTGS1)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102109794 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102109794
NCBI-ProteinID: XP_005529236
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MGGGCRARAPPAAGLRLLLAHAVLLCSAGSAAGTGSVNPCCYFPCQNQGVCVRVGLRGYE
CDCTRTGYYGVNCTSPEFWTRLHNLLKPSPAFYHFILTHFKWFWDIINSTFIRDTLMRLV
LTVRANLIPSPPTFNSDYGYISWEAYANVSYYTRILPPVPDDCPTPMGTKGKLQLPDPQL
LAERFLLRQKFEADPRGTNMMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGD
NLQRQHQLRLFRDGKLKFQVVDGEVYPPMVTEAPVHMVYPSGVPKEQQLAVGQEVFGLLP
GLCVYATLWLREHNRVCDLLKQDHPTWSDEQLFQTARLILIGETIKIVIEDYVQHLSGYY
LSLKFDPELLFGSQFQYRNRIAVEFNQLYHWHGLMPDSFIIQGQEYSYKQFLYNTSMLMD
YGVEALVESFSKQVAGRIGGGHTINANVLHVAVGVIKESRQLRLQPFNEYRKRFGLKPFK
SFQELTGEEEKAAELEELYGDIDALEFYPGLLLEKPQPNSIFGESMVEIGAPFSLKGLFG
NPICSPEYWKPSTFGGATGFEIVKTASLKKLVCLNVKKCPYVAFHVPDAAEHGSPRAGGS
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgggtgccgggcccgggcccctccggccgcggggctccggctgctgctcgcc
cacgccgtgctgctctgctccgccgggagcgccgccggcaccggctccgtgaacccctgt
tgctatttcccctgccagaaccaaggggtgtgtgtgagggtgggcctgagaggatacgag
tgcgactgcacacggacgggctactacggggtcaactgcacctcccctgagttctggaca
cgtctccacaacctcctgaagcccagtcctgccttctaccacttcatcctgacccacttc
aagtggttttgggacattatcaacagcaccttcatcagggacacgctcatgaggctcgtg
ctgacagttcgtgccaatctcatccccagcccccccactttcaactctgactatggctac
atcagctgggaggcctatgccaacgtcagctattacacccgcatcctcccgcccgtgccg
gacgactgccccacgcccatggggaccaaagggaagctgcagctccccgacccccagctc
ctggcggagaggttcctgctgcggcagaagtttgaagctgatccccgaggcaccaacatg
atgtttgccttcttcgcccagcatttcacccaccagttcttcaagacatctgggaagatg
ggacgcggcttcaccaaggcgctggggcacggggtggacctgggacatttgtacggggac
aacctgcagcggcagcaccagctgcgactcttccgagatgggaagctgaaattccaggtg
gtggatggagaggtgtacccacccatggtcaccgaggctccggttcacatggtgtaccca
tcaggagtgcccaaggagcagcagctggcggtggggcaggaggtgttcgggctgctgccg
gggctctgcgtgtatgccacgctctggctacgcgagcacaaccgcgtctgcgacctgctc
aagcaggaccatcccacctggagcgacgagcagctcttccagacggcgcggctcatcctc
atcggggagaccattaagattgttattgaagactacgtccagcacctcagtgggtactac
ctgagcctcaagttcgaccccgagctgttgttcgggtcacagttccagtaccggaatcgc
atcgcggtggagttcaaccagctctatcactggcacgggctgatgcccgactccttcatc
atccagggacaggagtacagctacaagcagttcctctacaacacctccatgctcatggac
tatggcgtggaggcgctggtggagtccttttccaagcaggtggcaggaaggattggtggg
ggacacaccatcaatgccaatgtcttgcacgtggctgttggggttatcaaggagtcccgg
cagctgaggctgcagcctttcaatgagtatcggaaaaggtttggcctgaagcccttcaag
tccttccaggagctgacaggagaggaagaaaaggcagcagaactggaagagctgtatgga
gacattgatgctctggagttttacccaggcttgctgcttgagaaaccccaacccaacagc
atttttggggaaagcatggtggagatcggagctccattttccctaaaggggctttttgga
aatcccatctgctccccagagtactggaaacccagcacatttggtggagcaaccggcttt
gagattgttaagacggcatccctcaagaagctcgtgtgcctcaatgtgaagaagtgcccg
tacgtggcgttccacgtgccggatgctgcggaacacggcagccctcgggctggtggatca
tctacagagctctag

DBGET integrated database retrieval system