KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110138Help
Entry
102110138         CDS       T02921                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00052  Galactose metabolism
phi00500  Starch and sucrose metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102110138 (GANC)
   00500 Starch and sucrose metabolism
    102110138 (GANC)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102110138 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110 POC3_POC4
Motif
Other DBs
NCBI-GeneID: 102110138
NCBI-ProteinID: XP_005522656
LinkDB All DBs
Position
Un
AA seq 914 aa AA seqDB search
MEAGTPGGVSVQDEAVDKSNFKKCNQIAFYRRQKLLHPGKSLYRVLLDSVTLSDENVKFQ
IIHEENKVLLQVEIYEIEGNIFRLKIDEASPLRARYKVPDVLIKEPTTKRLFISHKEEGI
LVLSSVNEDYKLQVTSNPFQVELQSKGETVMSMNSNGLLYFEHLQPPASDRKPTVQNEEA
ASDSSKEKQEDLGLWQEKFGNFLDIKAHGPTSVGMDFSLHGYDHVYGIPQHTETLLLKNT
SDGDAYRLYNLDIFGHKIHEKIGIYGSVPLLLAHKPNRTSGIFWLNSSETLVDISTKAVA
EHTPSKSAAETAKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDTFKQFAQLTGTQALPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDAHDIPYDVIWLDIEHTDGKRYFTWDTQKFQNPRK
MQEHLRKKKRKLVVIVDPHIKIDPSYTLYAQAKEKGYFVKDRNGQDFEGISWPGSSCYPD
FTNPEVRKWYADQFAFKTYKASTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHREV
HNLYGFYQQMATAEGLIRRSSGKERPFVLTRSFFAGSQKYGAVWTADNTADWSYLKISIP
MLLTINMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMESKRREPWLFGE
KNTQIIRRAIRERYVLLPYLYTLFYRAHTAAEPVMRSLWIEFPEKMETFDVENEYMLGNA
LLVHPVTEKEAKTVTVLFPGPEEIWYDFRKFKQIEDAGTVKIPVTLENIPVFQRGGTVIP
LKTTAGKSTEWMIDISYELHVALDTEACAIGELYIDDGHSFQYLHKKQFLYRKFTFHKNV
LSSSCIDGSGQYHTTCVVERVIILGFGKHPTSVTASSKDGKKTEVVFTYDTKTSALTLEN
IALSVDADWEICIG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggacgccggggggagtcagtgtccaagacgaggctgtggacaaaagcaac
tttaagaaatgcaaccaaattgctttttacaggcgtcagaaacttctacatcctggaaaa
tccttgtatcgagtgttgttggattcagtcacattaagtgatgagaatgtcaaattccaa
atcatccatgaggagaataaggttcttctacaagtagaaatttatgaaatagaaggcaat
attttcaggcttaaaatcgatgaggcatctcctctcagagcaaggtacaaagttcctgat
gttcttataaaggaacctaccaccaagagactgttcatatcccacaaggaggaaggtatt
ttggtactgtcaagtgttaatgaggactacaaacttcaagtcacatcaaaccccttccaa
gttgagctgcagtccaagggtgagactgttatgagcatgaattccaatgggctgttgtat
tttgagcacctacaacctcctgccagtgacagaaaacctacagtacaaaatgaggaggca
gcaagtgattcctctaaggaaaaacaagaggatctaggtctctggcaagagaaatttggc
aatttcttagacatcaaagctcatggtcctacttctgtaggcatggacttctctttacat
ggatatgaccatgtttatggaataccacaacacacagaaacacttcttcttaaaaacacc
agtgatggtgatgcctaccggctatataatttggatattttcggccacaagatacatgaa
aaaataggcatttatggttcagtaccccttctcttagcacacaagcctaacagaacttca
gggatcttctggctgaactcttcagaaacactggtggatattagtacaaaggcagtagct
gagcacactccatccaaatctgctgcagagactgctaagcagagagcagtgcctctaact
gatgtacgctggatgtcagaaagtgggatcattgatgttttcctgctgatgggacccact
gcatttgataccttcaagcagtttgcacaactgacaggcactcaagcattgcccccactt
ttttctctgggctaccatcagtgcaggtggaattatgaggatgagcaagatgtcaaggca
gtggatgctggctttgatgcacatgacattccttatgatgtcatatggctggatatagag
cacacagatggaaagaggtattttacttgggacacacagaaattccagaaccccagaaag
atgcaagagcatctcaggaagaaaaaacgcaagcttgtggtcattgtagaccctcatatt
aagattgatccctcatataccctgtatgcacaggcaaaagaaaagggatattttgtgaaa
gacagaaatgggcaagattttgagggcatcagttggccaggttcctcttgttacccagat
ttcaccaatcctgaagtgcgaaaatggtatgcagatcaatttgccttcaaaacatacaag
gcatccactaatatcctctttgtatggaatgatatgaatgagccttcagtcttcaagggg
gcagagctaacaatgcagaaggatgctgtgcattacaacaactgggagcaccgggaagta
cacaacctctatggattctaccagcaaatggcaactgcagaaggactcatcagacgttct
tcaggaaaagagagaccatttgtactcacacgatctttctttgctggatcacagaagtat
ggggcagtgtggactgcagacaacacagcagactggagttacctgaaaatatccattcca
atgcttcttaccatcaacatggcagggatttcattctgtggagctgatgtgggagggttt
attggagatccagaaccagagttacttgttcgctggtatcaggcgggagcctaccagccc
ttcttcagaggtcactctaacatggagagcaaacggcgcgaaccgtggctctttggggag
aagaacacccagatcatcaggagagccattagagagcgctacgtcctcctgccctactta
tacactctgttctatcgggcacacacggcggctgaacccgtcatgaggtctctctggata
gagtttccagagaaaatggaaacttttgatgtggaaaatgagtacatgctgggaaatgct
ttgttggtgcatccagtcacagagaaagaggccaagacagtgacagttctgtttccaggg
ccagaggagatttggtatgatttcagaaaatttaagcaaatagaagatgcaggcacggtg
aagatcccagtaacactggagaatattcctgtattccagcgggggggcactgtgatacct
ctgaagaccacagctggaaaatccactgaatggatgatagatatttcttatgagctccac
gtggccttagatacagaggcctgtgccataggtgagctctacatagatgatgggcattca
tttcaatatctccacaagaaacagttcctgtatcggaaattcactttccacaagaacgtt
ctctcttccagctgcatagatggaagtggacagtaccacactacatgtgtagttgaacgg
gtgattattctgggattcggaaagcatcccacttcagtgacagccagttccaaggatggg
aaaaaaacagaagtggttttcacatatgatacgaagacctctgcgctgacactggaaaac
atagccctgagtgttgatgctgactgggagatctgtatcggctga

DBGET integrated database retrieval system