KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110822Help
Entry
102110822         CDS       T02921                                 

Gene name
GALNT5
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 5
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00512  Mucin type O-glycan biosynthesis
phi00514  Other types of O-glycan biosynthesis
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102110822 (GALNT5)
   00514 Other types of O-glycan biosynthesis
    102110822 (GALNT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phi01003]
    102110822 (GALNT5)
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102110822 (GALNT5)
Glycosyltransferases [BR:phi01003]
 O-Glycan biosynthesis
  Mucin-type
   102110822 (GALNT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102110822
NCBI-ProteinID: XP_005520001
LinkDB All DBs
Position
Un
AA seq 824 aa AA seqDB search
MSGLRRLFRGSGRALALVFAASVAWLLLDMAALRLSLGEAGGRLLREAAGLAPGPGPGLR
PGLGLGRPRRGPEAPAGDAGAAPAPAASPPPRQRPGPGGTGAELLGAHGSEQRPSGTAAP
SGRAAQPGAQETNTGREETPSKTRFILISKDGMDLAGPAAPRRGPHSAGNATRRRGKHKE
LADKSRDGAHAATATAAATDMGGRSRTLGATPRAAPGGAGTGQDGQERGAAAPGGAGSDK
DGQERGAAAPGGAGTDKDGQERGAAAPGGAGTGQDGQERGAAAPGGAGTGQDGQERAGSS
PGMHKVLSMDATLAPRDPRAPGQFGHPVAVPDDKQEEAKSRWKEGNFNVYLSDLIPVDRA
IADTRPAGCSEQQVHDDLPTTSIIMCFVDEVWSTLLRSVHSVLSRSPPHLIEEIILVDDF
STKEYLREQLDTYMSRFPKVRILRLRERHGLIRARLAGAEIAKGAVLTFLDSHVECNVGW
LEPLLDRVRLRRTKVACPVIEVISDKDMSYMTVDNFQRGIFTWPMNFGWRQIPQEVIEKN
KIKETDIIRCPVMAGGLFSIHKQYFFELGMYDPGLDVWGGENMEISFKVWMCGGEIEIVP
CSRVGHIFRNDNPYSFPKDRVRTVERNLARVAEVWLDEYKELFYGHAYHLLLGNVDVGDL
SQQIQLRKKLRCKSFRWYLENVYPDLEAPLVKASGLLVNAALAGCIAVEGTGLAFEECDV
NNTNQKFNYTWLRLIQHGELCLAPSGVVGAVGLRRCQPRSRSLAWLHKSLATVQPGLTDH
IISEHQHLPQPCLEVDPSYRALRLKACDPTNPHQKWHFGRYHAD
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctgcggcggctgttccgcggcagcggccgggccctggccctcgtgttcgcc
gcctcggtggcctggctgctgctcgacatggccgcgctccgcctctcgctcggcgaggcg
ggcgggcggctgctgcgggaggcggcggggctggcaccggggccggggccggggttgcgg
ccggggttggggttggggcggccccggcgaggccccgaggctccagcgggggatgcgggg
gcagccccggccccggcggcatcgccgcccccccggcagcggcccgggcccggcgggacg
ggcgcggagctcctcggagcccacgggagcgagcagcgcccctccggcaccgcggcaccg
agcggccgggcagcccagcccggagcgcaggaaacaaacacgggacgggaggaaactccc
tccaaaactcgcttcatcctcatcagcaaagacgggatggacctcgccggccccgcagcc
ccgcgccgtgggccccactctgcgggaaacgccacaaggagacgtggaaagcacaaggaa
cttgctgacaagagcagggatggtgcccacgccgccactgccactgctgcggccaccgac
atgggtggcaggagccggacgctgggtgcgacaccaagagcagctcctggaggagcgggc
actggccaggatgggcaggagagaggggcagcagctcctggaggagcgggcagtgacaag
gatgggcaggagcgaggggcagcagctcctggaggagcgggcactgacaaggatgggcag
gagagaggggcagcagctcccggaggagcgggcactggccaggatgggcaggagagaggg
gcagcagctcctggaggagcgggcactggccaggatgggcaggagagagcagggagcagc
ccagggatgcacaaagtcctgtccatggatgcaacgctcgccccgagagacccccgagct
cctggccagtttggacaccctgttgctgtccctgatgataaacaagaagaagcaaaaagc
agatggaaagaaggaaactttaatgtctacctcagcgacctgatccctgtggatcgagcc
atcgcagacaccaggcctgccgggtgctcagagcagcaggtccacgacgacctccccacc
accagcatcatcatgtgcttcgtggatgaggtgtggtccaccctcctgcgctccgtgcac
agcgtcctcagccgctctcctcctcacctgatcgaggagatcattctggtggatgacttc
agcactaaagagtacctgcgggagcagctggacacctacatgtcgcggttcccgaaggtg
aggatcctgcgcctcagggagaggcacgggctgatccgggccaggctggcgggagccgag
atcgccaaaggcgctgtcctgacgttcctggactcgcacgtggagtgcaacgtgggctgg
ctggagccgctgctggacagggtccgcctgcgccggaccaaggtggcctgccccgtcatc
gaggtcatcagcgacaaggacatgagttacatgaccgtggacaacttccagcgtgggatt
ttcacttggccgatgaattttggatggaggcagattccacaagaggtcatagagaaaaat
aaaatcaaggagactgatattataaggtgccccgtcatggcaggtggcctgttctccatc
cacaagcagtacttctttgagctgggaatgtacgacccgggactggatgtctggggaggg
gaaaatatggagatttcattcaaggtctggatgtgcggaggagagatcgagatcgttccg
tgctcccgggtggggcacattttcaggaatgacaatccttactccttccctaaagaccgg
gtgaggacggtggagcggaacctggcccgcgtggcagaggtgtggctggacgagtacaag
gagctgttctacggccatgcctaccacctgctcctgggcaacgtggatgtcggagacctg
agccagcaaatccagctgcgcaagaagctccgctgcaaaagcttccgctggtacctggag
aacgtctacccggacctggaagctcccctggttaaagccagcgggctgctcgttaacgcg
gccctggcagggtgcatcgctgtggaaggcaccggcctggcttttgaggagtgtgatgtt
aacaacacgaaccagaagttcaactacacctggctgaggctgatccagcacggagagctc
tgccttgccccgtctggcgtcgtgggagccgtgggcctgcgccgctgccagcccaggagc
cgcagcctggcctggctccacaagtcactggccaccgtgcagccggggctgaccgaccac
atcatctcggagcaccagcacctcccgcagccctgcctggaagtggatccctcgtacaga
gccctgcggctgaaggcctgtgaccccacaaacccccaccagaagtggcactttggcagg
taccacgcggactga

DBGET integrated database retrieval system