KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111137
Entry
102111137         CDS       T02921                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102111137 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102111137 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phi04052]
    102111137 (KITLG)
Cytokines and growth factors [BR:phi04052]
 Growth factors
  Growth factors (RTK binding)
   102111137 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102111137
NCBI-ProteinID: XP_005519467
LinkDB
Position
Un
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFSDIPDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADRLDKNDCILPSTVGTPENDS
RVAVTKTFLFPPVAASSLRNDSIGSSTNSNKEVLGFISSSSLQGISIALTSLLSLLIGFI
LGAIYWKKIHPKSRPESDETTQCHDYQEENEISVLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactactcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtcacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatctgataacccttaaatatgtcccgaag
atggatagtctgcctaatcactgttggttgcatttgatggtgcctgaattttcgaggagt
ctgcataatcttctccagaaattttcagatattccagatatgtcggatgttttaagcaac
tattcaatcatcaacaatctcacaaggataattaatgatcttatggcatgccttgctttt
gataaaaacaaggattttgtaaaagaaaatggtcacctttatgaagaaggtcacttcatt
cctgaggacttttttaggcactttaatagtaccattgaggtctacaaagagtctgcagac
agattggataagaatgactgcattctgccttcaacagtaggaacaccagaaaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctctcttaggaat
gacagcattggcagtagcactaacagtaacaaagaagtacttggcttcattagcagctcc
agcctgcaagggatcagcatagctctgacatcattgctgtctctccttattggctttatt
ttgggagccatatactggaagaaaatacatcccaaatccagaccagaaagtgatgaaact
acacagtgtcatgactatcaagaggaaaatgagataagtgtgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system