KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111511Help
Entry
102111511         CDS       T02921                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00601  Glycosphingolipid biosynthesis - lacto and neolacto series
phi01100  Metabolic pathways
Module
phi_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102111511 (B3GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phi01003]
    102111511 (B3GALT1)
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     102111511 (B3GALT1)
Glycosyltransferases [BR:phi01003]
 Glycan extension
  Type 1 chain
   102111511 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 102111511
NCBI-ProteinID: XP_014105071
LinkDB All DBs
Position
Un
AA seq 326 aa AA seqDB search
MASKVSCLYILTVVCWASALWYLSITRPTSSYTGHRQVSSISIARKNVSFGNIRTRPINP
HSFDFLINEPSKCEKSAPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPNTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQITPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcatgtttatacattttgacagtagtttgttgggcaagcgctctt
tggtacttaagtataactcgtcctacttcttcctacacgggccacagacaggtcagtagc
atatccatagccagaaaaaatgtttcctttggcaacataagaactcgacctataaatcca
cattcctttgacttccttatcaatgaacccagcaaatgtgagaagagtgccccgttcttg
gtcattcttatcagtacaactcacaaagagtttgatgcaaggcaagccattcgagaaacg
tggggagatgaaaacaactttaaaggaattaaaatcgctacactatttcttcttggaaaa
aatgcagatcctgtgttaaatcaaatggtagagcaagaaagccaaatttttcatgacatt
attgtggaagattttatcgactcttaccataacctcactctgaaaacattgatggggatg
aggtgggtagcaacattttgttcaaaagcaaagtacgttatgaagacagacagtgatatt
tttgtaaatatggacaatcttatttataagctgctcaaacctaacaccaagccaaggaga
aggtacttcacgggttatgttataaatggaggaccaataagagacgttcgcagtaagtgg
tacatgcccagagatttgtatcccgacagcaattacccacccttctgttcaggcactggc
tacattttttcagctgatgtagcagaactgatttacaaaacctcccttcatacccgactt
cttcatcttgaagatgtgtacgttggactctgccttcggaagctgggcattcaccccttc
caaaacagtggcttcaatcactggaaaatggcctacagcttgtgcaggtaccgcagggtg
atcacagtgcaccagataacaccagaagaaatgcacagaatttggaatgacatgtccagc
aagaagcatcttagatgctaa

DBGET integrated database retrieval system