KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111789Help
Entry
102111789         CDS       T02921                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102111789 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102111789 (HDAC4)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102111789 (HDAC4)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102111789 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 102111789
NCBI-ProteinID: XP_005532750
LinkDB All DBs
Position
Un
AA seq 1091 aa AA seqDB search
MLEEEQQNVDGLSGRDQPVELLNPPRVNHMPSSVDVSTALPLQVAPSSVPMDLRLDHQFS
MPVTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEM
LAMKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEF
VLNKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDD
FPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTGTADSACNSA
PGSGPSSPNNSSNNISTENGIAGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNIT
LGLPATGPSSAGQAQQDAERLAIPALQQRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQ
HMVLLEQPTAQTPLVTDWYLSGLPLHAQPLVGGERVSPSIHKLRQHRPLGRTQSAPLPQN
AQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKIISKPAEPARQHESHPEETEEELREHQ
ALLEEPYGDRAAGQKEPPALASVVQVKQEPIESDEEEAEPQQELESGQRQAEQELLFRQQ
ALLLEQQRIHQLRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFT
TGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQT
VHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARL
AVGCVIELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSK
ILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMA
FTGGLDPPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCF
GYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVFQQRANANA
VHSMEKVIEIHSKYWHSLQRFASTVGYSLVEAQKCENEEAETVTAMASLSVGVKPAEKRP
EDEPMEEEPPL
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagaagagcagcaaaatgtggatgggctttctggcagagaccagccagtggag
ctgttgaatccacctcgagtgaaccacatgcccagctctgttgacgtgagcacagccctg
cccttgcaagtggcgccgagctcggtgcccatggacctgcggctggaccaccagttctcc
atgccggtgacggagcccacgctgcgggagcagcagctgcagcaggagctgctggccctc
aagcagaagcagcagatccagaggcagatcctgatcgcagagttccagcggcagcacgag
cagctttcccggcagcacgaggcgcagctgcacgaacacatcaagcagcagcaggagatg
ctggccatgaagcatcagcaggagctgttggagcaccagaggaagttggagcagcaccga
caggagcaggagctggagaagcagcaccgagagcagaaactgcagcagctaaaaaacaaa
gagaaagggaaagagagtgcagtggcaagcacagaagtgaagatgaagttgcaggaattt
gtgttaaacaagaagaaggctctggcccaccggaatctcaaccactgcatatccagcgac
cctcgcttctggtacgggaagactcagcacagctctctggaccagagctccccaccccaa
agcggcgtctccggcacctacaaccacccggtcctggggatgtacgattccaaagatgac
ttcccactcagaaaaacagcctctgaacccaacctgaagctgcgctccagactaaagcag
aaggtggcagagaggaggagcagccccctcctgcgcaggaaggacgggcctgtggtgacg
gcgctcaagaagcgcccgctggacgtcacaggtactgcggactctgcatgcaacagtgct
cctggatctggtcccagctctccgaacaacagctccaacaacatcagcactgagaacgga
atcgcaggatcagtcacgagtatccaagcagagaccagcctggctcacaggctcgtgaac
cgtgagggctccgtgacgcagctcccgctctacacctcgccctccctgcccaacatcacg
ctaggactgcctgccaccggcccctccagtgcgggacaagcacagcaggacgcagagagg
ctcgcaatcccagccttacagcagcggatctccttattccctggcactcacctcactccc
tacctgagcactacaacgttggagagggatgggggaactgcacacaaccctctcctgcag
cacatggtcctactggaacagccaactgcacaaacacccctggtcacagactggtatctt
tcaggactgcccctgcacgcacagcccctggtgggtggagagagggtctccccttcgatc
cacaagctgcggcagcaccgcccgctcgggcgcacccagtctgctcccctgccccagaac
gcccaggccctccagcagctggtgatccagcagcagcaccagcaattcctggagaaacac
aaacagcaattccagcagcagcagctgcacatcaacaagatcatctccaagcccgcggag
ccggcgcggcagcacgagagccaccccgaggagacagaggaggagctgcgggagcaccag
gccctgctggaggagccctacggcgacagggccgcgggccagaaggagcccccggcgctg
gccagcgtggtgcaggtcaagcaggagcccatcgagagcgatgaggaggaggcagagccg
cagcaggagctggagtccgggcagaggcaggcggagcaggagctgctcttccgccagcaa
gccctgcttctggagcagcagcggattcaccagctgaggaactaccaggcgtcactggag
gccgctggcatgcccgtgtccttcgggggacaccggcccctgtcccgggcacagtcctcc
cccgcctcagccaccttccccatgtccgtgcaggagccacccactaagccaaggttcaca
acaggccttgtgtacgacacgttgatgctgaagcaccagtgcacctgtggaaacaccaac
agccaccccgagcacgcgggcaggatccagagcatctggtccaggctccaggagacgggg
ctgcggggcaagtgtgagtgcatccgtggcagaaaggcaacgctggaagagctgcagacg
gttcactcggaagcccacacgctgctttacggcacaaaccctctgaacaggcagaaactg
gacagcaagaagcttctaggttccctaacgtcgatgtttgtcaggctgccttgcggtggt
gttggggttgacagtgacaccatttggaacgaggtgcactcctctggcgctgctcgcctg
gccgtgggctgtgtcatcgagctggtgttcaaagtggccacaggagaactgaagaatgga
tttgctgttgtccggcccccgggccaccacgcggaggagagcacacccatgggtttctgc
tattttaactctgtggcaattgcagccaagctgctccagcaaaggctcaatgtgagcaaa
atcctcatcgtggactgggatgtccaccacgggaatggtactcagcaggccttctacaac
gatcccaacgtcctttatatctcactacaccgctatgatgacggcaacttcttcccaggc
agcggtgctccggatgaggttggcacaggagcaggagtcggtttcaatgttaacatggca
tttactggtggcctggatccgcccatgggagacacggaatatttaactgccttcaggaca
gtagtgatgcccattgccaacgagtttgccccagacgttgtgctggtgtcatctggtttc
gatgctgtggaagggcaccccacacccctcggaggatacaatctgtcagcaaaatgcttc
gggtacctgacgaagcagctgatgggcctggccgggggccgcgtcgtgctggccctggag
ggtggccacgacctcacggccatctgcgatgcctcggaggcttgtgtgtcagccctgctg
ggaaacgagcttgaccctcttccggagaaggtattccagcagagagcaaacgctaatgcg
gtgcattccatggagaaagtcattgagatccacagcaaatactggcattccctccagcgt
tttgcctccacggtgggatattccctggtggaggcccagaagtgtgagaatgaggaggcg
gagacggtgacggccatggcatcactgtcagtgggcgtgaagccggcggagaagagacct
gaggacgaacccatggaagaggagcctccactgtag

DBGET integrated database retrieval system