KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111890Help
Entry
102111890         CDS       T02921                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phi01002]
    102111890 (PCSK2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:phi03110]
    102111890 (PCSK2)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102111890 (PCSK2)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S8: subtilisin family
   102111890 (PCSK2)
Chaperones and folding catalysts [BR:phi03110]
 Intramolecular chaperones
  Subtilisin family
   102111890 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N Minor_tail_Z
Motif
Other DBs
NCBI-GeneID: 102111890
NCBI-ProteinID: XP_005525560
LinkDB All DBs
Position
Un
AA seq 638 aa AA seqDB search
MPPGPPLLRGSLLLLLLHFLGAPAREAVYTNHFLVELHDGGQAEAERVAAEHGFGGVRKL
PFLESGYFFYHNGLAKARRRRSLQHKLRLEKDSRVRKAVQQEGFIRRKRGYRDINDIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAKASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANSHLTWRDMQHLTVLTSKRN
QLHDEVHRWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSIQEPEKIP
PSGKLFLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDPRGTWALEIGFVGSQPQRGVLKEWTLMLHGTQSAPYI
DQIVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggggccgccgctgcttcggggctccctcctcctcctcctcctgcacttcctc
ggcgccccggcccgcgaagccgtctacaccaaccatttcttggtggagctgcacgacggg
ggccaggcggaggccgagcgggtggcggcggagcacggcttcggcggggtgcggaagctc
ccttttttagaatctggatactttttttatcacaatggtcttgctaaagccaggagaaga
cgcagccttcaacacaagcttcgtctggaaaaggactccagggtgaggaaagctgtgcaa
caggagggcttcatcaggaggaagcgaggatatagagacatcaatgacattgacatcaac
atgaatgatcctttatttacaaagcagtggtacctgattaacactggtcaagcagatggg
actcctggacttgaccttaatgtagctgaagcatgggagctgggatacacagggaaggga
gtaaccataggaattatggatgatggaattgattatctgcatccagatcttgcatcaaac
tacaatgccaaagccagttatgacttcagcagcaatgatcccttcccctatccccgctat
acagatgactggtttaacagccacgggacaaggtgtgcaggagaggtgtctgctgctgcc
aacaacaacatctgcggcgtgggagttgcgtacaactccaaagtggcaggtattcgaatg
ctcgaccagccgtttatgacagacatcatcgaggcttcctccatcagtcatatgcctcaa
gtcatagatatatatagtgccagctggggaccaactgataatgggaagactgtggatgga
cctagagagttaacgctgcaagcaatggcagatggtgtgaataagggccggggtggaaaa
ggcagcatctatgtctgggcctctggagatggaggcagctatgatgactgtaactgtgat
ggctatgcatcgagcatgtggacaatctccatcaattctgccataaacgatggacggaca
gctctgtatgatgaaagctgctcttcaaccttagcctccacctttagtaacggcaggaag
agaaatccggaggctggcgtggctacaacagatttgtatggcaactgcaccctgcgtcat
tcgggcacgtctgcagccgcccctgaagcagccggagtgttcgccctggccctggaggct
aactcacatctgacatggagagacatgcagcatctgacagtgctcacctccaagaggaac
cagctccacgatgaggttcacaggtggcggaggaatggcgttgggctggagttcaaccat
ttgtttggctacggtgtcctagatgcaggagcaatggttaagatggcaaaagactggaag
actgttcctgagagattccattgtgttggggggtcaatacaggaacctgaaaagatacca
ccaagtggcaaactgttcctcacactgacaactgatgcgtgtgaggggaaggagaacttt
gtccggtaccttgaacatgttcaggcagtcataactgtgaattccactcggcgaggagac
ctcaacatcaacatgacctcaccaatgggaacaaagtccattttgctgagccggcgcccc
agggatgatgactccaaggtgggttttgacaaatggcctttcatgacgactcacacttgg
ggagaagacccccgaggcacctgggctctggagattgggtttgttggcagccagccccag
cggggtgtgctgaaggagtggacactgatgctgcacgggactcagagtgcaccgtatata
gaccaaatcgtaaaagattatcagtccaaactggccatgtccaagaaggaagagctggaa
gaagagttagatgaagcagtggagagaagcctgaagagtatactgagcaagaactag

DBGET integrated database retrieval system