KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111949
Entry
102111949         CDS       T02921                                 

Gene name
HHATL
Definition
(RefSeq) hedgehog acyltransferase-like
  KO
K24679  protein-cysteine N-palmitoyltransferase HHAT-like protein
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102111949 (HHATL)
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 102111949
NCBI-ProteinID: XP_005527846
LinkDB
Position
Un
AA seq 504 aa
MGVKAMLPSYELGFYALVVTCAVLYSGSDIFQASRDSMNRKAFRDGIKPGWHYFGRKMDV
ADFEWVMWFTSFRNIIIFALSGHILFGKICSMTVPQHRAVMYMIYGVLAVLGSMGLVYLM
IILSHCLVLYSVALAKQKWLCYVAGLCCLASFKVEPFGSWQSGFVTGAFDLQDVLFYGGC
TFTIMRCMSFALESSEKEEGIYSIFDLLKYNFYLPFFFFGPVMTFDQFHAQVSTRELRRK
DDEMKNIRVNALLHVGAIVAVDIFFHFFYILTLPSDLKFVNRLSDWSLAGLAYSNLVYDW
VKAAVMFGVINTIARLDHLDPPQPPKCITMLYIFAETHFDRGINDWLCKYVYDHIGENHD
NILKELVASITTFAITTLWLGPCEVVYIWSIVNCFGLNFELWVQKFFQLGPFAKLEAKLS
GAMSRRIRAAFGAVNFWAIVLYNILALNSLEFALLVTKRLLVMGFPVSTLSIWFITYCGV
QLIKERERILAIEEEEKGDKAKVE
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgggggttaaagcgatgctccccagctacgagctgggcttttatgctctggtggtgacc
tgtgctgtgctctacagcggcagcgacatcttccaggcatccagagacagcatgaacaga
aaggcctttcgggatggaataaagccaggctggcactacttcggcaggaagatggacgtg
gctgatttcgagtgggtgatgtggttcacctcgttcaggaacatcatcatcttcgccctc
tctggacacatcctcttcggcaagatctgctccatgactgtgccacagcaccgggctgtg
atgtacatgatctacggggtcctggctgtgctgggcagcatggggctggtctacctgatg
atcatcctctcccactgcctggtcctctactcggtggccctggccaagcagaagtggctg
tgctacgtggccgggctctgctgccttgcctccttcaaggtggagcccttcggctcctgg
cagagcgggtttgtaacgggagcttttgatctccaagatgtccttttctacggaggatgc
accttcaccatcatgcgctgcatgagcttcgccctcgagagctctgagaaggaagagggc
atctactccatcttcgacctcctcaagtacaacttctacctcccattcttcttctttggg
cctgtcatgacctttgaccagttccatgcccaggtgagcacccgagagctgcggcgcaag
gacgatgagatgaagaacatccgtgtcaatgccctgctccacgtgggggccatcgtggct
gtggacatcttcttccacttcttctacatcctcaccctcccttccgacctgaagttcgtg
aaccgcctctcggactggtccttggctggcctggcctactccaatctggtgtatgactgg
gtgaaagctgctgtcatgtttggggtcatcaacaccatcgccagactggaccacctggac
ccaccccagcccccaaagtgcatcaccatgctctacatctttgccgaaacgcattttgac
agagggattaatgactggctgtgcaagtacgtgtatgaccacattggagagaaccacgac
aacatcctgaaggagctggtggccagcatcaccacctttgccatcaccacgctgtggctg
gggccctgtgaggtcgtttacatctggtccatcgtcaactgcttcggcctcaacttcgag
ctctgggtacagaagttcttccagctggggccttttgccaagctggaggccaagctgtca
ggggccatgtctcggaggatcagggcagcttttggggcggtgaacttctgggccattgtc
ctctacaacatcctggccctcaacagcctggagtttgcactgctggtgaccaagagactc
ctcgtgatgggtttccctgtgagcaccctgtccatctggttcatcacctactgcggagtg
cagctgatcaaggagcgcgagcgcatcctggccatcgaggaggaggagaagggtgacaag
gcaaaggtggagtag

DBGET integrated database retrieval system