KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112112
Entry
102112112         CDS       T02921                                 

Gene name
DISP1
Definition
(RefSeq) dispatched RND transporter family member 1
  KO
K24680  protein dispatched 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102112112 (DISP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:phi04990]
    102112112 (DISP1)
Domain-containing proteins not elsewhere classified [BR:phi04990]
 Other domain-containing proteins
  Patched domain-containing proteins
   102112112 (DISP1)
SSDB
Motif
Pfam: Patched MMPL Sterol-sensing
Other DBs
NCBI-GeneID: 102112112
NCBI-ProteinID: XP_005523366
LinkDB
Position
Un
AA seq 1542 aa
MAMSNASDSVVLSNGSILSNAAGPGVVAANDGDITVQQLPSKETSRTKPSQNGCLQLNGT
IKPSFLPLDNQRTQQMLSQCCHPCPYHHSLSSHNSKQDCHSVVGSSAPSPMTSCCMQPHT
EYSASICQKHTPVYQPACCLQPSPSFCLHHQWPDHFQHQPVQQHIARIRPARPFKLPKSY
AALIADWPVVVLGMCTVLIVVCALVGILVPDLPDFSDPLLGFEPRGTAIGQRLVTWNNMV
KNTGYKATLANYPFKYADEQAKSHQDDRWSDDHYEREKRQADWNFHKDTFFCDIPSDRYS
RVVFTSTEGENLWNLNAIKSMCNVDNLRIRSHSQFGDLCQRATAASCCPSWTLGNYIAIL
NNRSSCQKIVERDVSHTLKLLRTCAKYYYNGTLGPDCWDMNAKRKDQLKCTNVPRKCTKY
NAVYQILHYLVDKDFLSPKTADYVLPALKYSMLFSPTEKGESMMSIYLDNFENWNASDGV
TTVMGIEFGIKHRLFQDYLLMDTVYPAIAIVIVLLVMCVYTKSMFITLMTMFAIISSLII
SYFLYRVVFNFEFFPFMNLTALIILVGIGADDAFVLCDVWNYTKFDKPHAGTSETVSITL
QHAALSMFVTSFTTAAAFYANYVSNITAIRCFGVYAGTAILVNYVLMVTWLPAVVVLHER
YLLNIFSCFKKPQQRVYNNKNCWTVLCQMFHKIIFAVSEASRIFFEKVLPCIVIKFRYIW
LFWFLALTVGGAYIVCVNPKMKLPSLELSEFQVFRSSHPFERYDAEYKKLFMFERVHHGE
ELHMPITVIWGVTPEDNGDPLNPKSKGELQLDTSFNIASPASQVWILRFCQKLRNQTFFY
QTEEQDFTSCFIETFKQWMENQDCDEPSLYPCCSHWSFPYKQEVFELCIKRAIMELERST
GYHLDSKTPGPRFDLNDTIRAVVLEFQSTYLFTLAYEKMHQFYKEVDSWISNELSSAPEG
LSSGWFVSNLEFYDLQDSLSDGTLIAMGLSVAVAFSVMLLTTWNIIISLYAIVSIAGTIF
VTVGSLVLLGWELNVLESVTISVAVGLSVDFAVHYGVAYRLAPDPDREGKVIFSLSRMGS
AIAMAALTTFVAGAMMMPSTVLAYTQLGTFMMLIMCISWAFATFFFQCMCRCLGPQGTCG
QIPLPKKLRCSAFSQAFSGPQGGRSQNKSHPVSKYQLDSRSQKPEMEHEHYELEPLASQT
RICNPAEKVTYEETHICSELFSSRPQNSCVPMHPAYNSEVSKGIKNVANSAVLQTSIDQH
TVCPVFSQNRQCSCPDAYKQVAVKWSPHSCQQLSDTFCYQCSPSPGTVQVQSSVAPINAL
QQAAEGYVHPVQRVLHCSCLQGRLKRTMTQNSLPKNFFLQSVQQFQAHQRINRTDTHAHQ
NPEENVRTAPKVMSSSQFLCRNAAPLIVHCSECENSISNNQKGFCQQIDKCDEKGGTEAN
GVESKKASLSKQKKKAEGKIDQRSLQNDRVLKADQNDKKHLLTRSGREARSEGCHESSHC
CGKAIAVKCNSVDCQMPNVEANVPPMLMRPELSNESLLIKTL
NT seq 4629 nt   +upstreamnt  +downstreamnt
atggctatgagcaatgctagtgactctgtggtcctgagcaatggcagcatcttgtcaaat
gctgctggcccaggggttgttgcagcaaatgatggagacatcacggtccagcagctccca
tccaaggaaacatcaagaacaaaaccaagtcaaaatggctgcctgcaactaaatggtaca
atcaaaccatcctttctgcctttagacaaccaaagaactcagcagatgttgtcgcaatgc
tgccacccttgtccataccatcattctttaagtagccataatagcaagcaagattgtcat
tcagtggttggcagctcagcaccatctcctatgacctcgtgctgcatgcagccacacact
gagtactcagcctctatttgccaaaaacacacccctgtctatcagcctgcctgctgtctt
cagccctccccatccttctgccttcaccatcagtggcctgaccatttccagcatcagcca
gtgcagcaacacatagccaggataaggccagccagaccattcaagttaccaaaaagctac
gccgctctcatcgctgactggcccgtggtggtcctgggcatgtgcaccgtgctcatagtg
gtgtgtgcactcgtgggaatattagttccagatcttccagatttctctgatccactgctg
ggttttgagcccagagggactgccataggacagagattggtcacatggaacaacatggtg
aaaaacacagggtacaaagccacacttgcaaactatcctttcaaatatgcagatgagcaa
gctaaaagtcatcaagatgacagatggtcagatgatcactatgaaagagagaagaggcaa
gcagactggaacttccacaaggatacctttttctgtgatattccaagtgatcgctattca
cgagtggtgtttacatcaacagaaggagagaatttatggaatttgaatgcaattaagtca
atgtgcaatgtagacaacttgaggattagatcccattcccagtttggtgatctttgccag
agagccactgctgcttcatgctgtcccagctggacactgggaaactatattgctattctg
aacaacaggtcatcatgtcagaaaattgttgaacgggatgtctctcataccctgaagctg
cttcgtacttgtgccaaatactactacaacgggaccctggggccagactgctgggatatg
aatgccaagaggaaggaccaactcaagtgtacaaacgtgcctcgcaaatgtaccaagtac
aatgctgtttaccagatccttcactacctagtggacaaggatttcctaagcccaaagaca
gctgactatgtcttaccagctttaaaatacagcatgctcttctctccgactgagaaaggg
gaaagcatgatgagtatttacctagataactttgagaactggaacgcttctgatggtgta
acaaccgtcatgggaattgagtttggaataaaacataggttgtttcaagattacttgttg
atggatactgtgtatcctgccatagccattgtaattgttctgttagttatgtgtgtgtac
accaagtccatgtttatcacgctgatgactatgtttgcaataattagttccttgattatt
tcttattttctctatcgggtagtatttaattttgagttctttccattcatgaatctcacg
gcattgattatccttgttgggattggagcagatgatgcttttgtcttatgtgatgtttgg
aactacacaaagttcgataaacctcatgctggaacctctgagacagtgagcatcacattg
caacatgctgctctttccatgtttgtcacgagttttacaaccgctgctgccttctatgct
aattatgtcagcaatatcacagcaatcaggtgttttggtgtttatgctggcactgccatt
ctggtgaattatgttttgatggtaacatggctgcctgccgtagttgtattacatgaacga
tatcttctcaatattttcagttgctttaagaaacctcagcagagggtatacaacaacaaa
aactgctggacagtgttgtgccaaatgttccacaagattatttttgcagtctcagaggca
tccaggatattttttgagaaagttttgccatgcattgttatcaaatttcggtatatttgg
cttttctggttccttgccttaacagttggtggagcatatatcgtgtgtgtaaatccaaag
atgaaactgccgtcgttggagctctccgagtttcaggtatttaggtcttctcacccattt
gaacgatacgatgcagaatacaaaaaactctttatgtttgaacgtgtccaccacggagaa
gagctccacatgccgattacagtaatctggggtgtcacacctgaggataacggtgaccct
ttaaaccctaaaagcaaaggagagctgcagctagataccagttttaatatcgctagccca
gcttcacaggtttggattttacgtttctgtcagaagttaagaaatcaaacctttttttat
cagacggaagaacaagacttcacaagctgcttcattgaaacgtttaaacagtggatggaa
aatcaagactgtgacgagccatcactttacccctgctgcagccactggagcttcccatac
aaacaagaagtttttgaattatgtatcaagagagctataatggagctagaaagaagcaca
gggtaccacttagacagcaaaaccccagggcctcgctttgaccttaatgacaccatcagg
gcagtggtgttggagttccaaagcacctacctcttcacactggcttatgagaaaatgcat
cagttctacaaagaggtggactcatggatttcaaatgagcttagttctgctcctgaaggt
cttagcagtggttggtttgtaagtaaccttgaattttacgatcttcaggacagtctttct
gatggtactctgattgccatgggcctttcagtggccgtggcatttagcgtaatgcttctt
acaacttggaacataatcataagcctttatgcaatagtttcaatagctggaactattttt
gtcactgtaggttctctggttcttcttgggtgggagctgaatgtgttggaatctgtcaca
atctcagtggctgttggcttgtcagtggactttgctgttcattatggagtggcttatcgc
ttagcccctgaccctgaccgggaggggaaagtcattttttctttaagccgtatgggttct
gctattgcaatggctgccttgactacatttgtagctggggcaatgatgatgccctcaaca
gtgttggcatacactcagcttggcactttcatgatgcttataatgtgcattagctgggct
ttcgcaaccttcttcttccagtgcatgtgccgatgccttgggccccagggcacttgtggc
cagatcccactaccaaaaaaactgcggtgtagtgccttctctcaggccttttcaggaccc
caagggggcagaagtcaaaacaaatcacatcctgttagcaagtatcagctggactccagg
agtcagaaaccagaaatggagcatgagcactatgagcttgaacctctggcatcacaaacc
agaatctgtaaccctgcagagaaagtgacatatgaagaaactcatatctgctcagagctc
ttcagcagcaggccccaaaactcatgtgtgcctatgcatccagcctataatagtgaagtt
agtaaaggcatcaaaaatgttgctaattcagctgtgctgcagacgtctattgaccaacac
accgtatgcccagttttctctcaaaacaggcagtgtagctgtcctgatgcatataaacag
gtggcagtgaagtggagtccacactcctgtcagcagttaagcgacaccttctgttaccag
tgttctccttccccggggactgtacaggtccagagctctgtagctcccataaatgcttta
cagcaagctgccgagggttacgtgcatccagtccagcgtgtcctccattgcagctgcctt
caaggaaggctcaaaagaacgatgacacaaaactctctgcctaaaaattttttccttcag
tcagtgcagcagttccaggcacatcaaagaataaacagaacagatacacatgctcatcaa
aacccagaggaaaacgtaagaactgctccaaaggtgatgagctcctcacagttcctctgc
cgaaacgcagcacctctaatagtgcattgctctgaatgtgagaacagcatctcaaataac
caaaagggattctgtcagcagatagacaagtgtgatgaaaagggtggtacagaagcgaac
ggggtggaaagcaagaaagcctctctgtcaaagcagaaaaagaaagctgagggcaagata
gatcagcgttctttgcagaatgaccgagttttgaaggctgaccaaaatgataaaaaacac
ctgctgaccaggtcagggagagaagctcgctccgagggttgccatgaaagttcacattgt
tgtggtaaggcaatcgcagtgaagtgcaattctgttgactgtcaaatgccaaacgtcgaa
gccaatgtgcctcctatgttaatgcgcccagaactttccaatgaaagtttgttaataaaa
acactataa

DBGET integrated database retrieval system