KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112425
Entry
102112425         CDS       T02921                                 

Gene name
KIF3A
Definition
(RefSeq) kinesin family member 3A
  KO
K10394  kinesin family member 3A
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102112425 (KIF3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:phi04812]
    102112425 (KIF3A)
Cytoskeleton proteins [BR:phi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102112425 (KIF3A)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 102112425
NCBI-ProteinID: XP_005523538
LinkDB
Position
Un
AA seq 702 aa
MPINKPEKLDKPESCDNVKVVVRCRPLNDREKATGYKMSVNVDEMRGTITVHKTDSSNEP
PKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVP
ELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDV
GVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDG
NMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPY
RNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKD
AMLRQFQKEIEELKRKLEEGEEISGSETSDSEEEDEDGEIGEEKRKKRRDQAGKKKVSPD
KMVEMQAKIEEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEK
KVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRKELEEKEQERLDIEEKYTNLQE
EAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQILIIDNFIP
QDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVLDKKEKDPFEVDLSHVYLAYTE
ESLRQSLMKLERPRTSKGRSRPKTGRRKRSAKPGAVIDSLLQ
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgccgattaacaagcctgagaagctggacaagccggaaagctgcgacaatgtcaaggtg
gttgttcgctgccggcctctcaacgaccgtgagaaagctacgggctacaaaatgtcagtg
aatgtggatgagatgaggggaactataactgttcataaaacagactcatccaatgagcct
cctaagacgttcacatttgacacagtgtttggaccggagagcaaacagctggatgtctat
aatttaacagcaagacctattatagattctgtcttagagggatacaatggtactattttt
gcatatgggcagactggaacaggcaaaactttcaccatggaaggggtccgagcagttcct
gagctcagaggcatcattccaaattcctttgcccatatatttggtcacattgccaaggca
gagggggatacaaggtttttagttcgtgtctcttatctggaaatttacaatgaggaagtg
cgggacctactgggaaaggaccaaacacagaggttagaggtgaaagagagacctgatgtg
ggagtttatatcaaagacctttcagcttatgttgtaaacaatgcagatgatatggacaga
atcatgaccctgggccacaagaaccgttctgttggtgccacaaacatgaacgagcacagc
tctcgctctcacgccatcttcaccatcaccattgagtgcagtgagaagggggtcgatggg
aacatgcatgtgcgcatgggcaagctgcacctcgttgaccttgctggttctgaaagacag
acaaaaactggagccacagggcagagactgaaggaagccactaagatcaacctctctctc
tccacactgggcaatgttatctctgcactggtggatggcaagagcacccacgtgccctac
cgtaactccaaactcacacggctgcttcaggactccctggggggcaactccaaaaccatg
atgtgtgcaaacatcggaccagcagactacaactatgatgagaccatcagcactctcagg
tatgcaaacagagccaagaacataaagaacaaggccaggattaatgaggatcccaaggat
gctatgctccgccagttccagaaagaaattgaagagcttaagagaaaactggaagaaggg
gaagagatatctggttctgaaaccagtgattctgaagaggaggatgaagatggggagatt
ggagaagagaagcggaagaaacggcgggatcaagcaggtaaaaagaaagtttcccctgat
aagatggtagagatgcaagcaaagattgaagaggagagaaaagctcttgaaactaagctt
gatatggaagaagaagaaagaaataaagccagagctgaactggagaagagagaaaaggac
ttactcaaagctcagcaagagcaccagtctctgttggagaaactgtctgcattggagaaa
aaggtgattgtgggaggagtggacttgctggcaaaagcagaagagcaagagaagcttcta
gaagaatcaaacatggaactggaagaacgaaggaagagagcggagcagcttcgcaaggag
ctcgaggagaaggagcaagaacgcttggacattgaggagaagtacaccaacctccaggag
gaagcacagggaaaaaccaagaaactgaagaaagtttggaccatgcttatggctgcaaag
tcagagatggcagatctacaacaagagcatcagagagagattgaagggttgctggaaaac
attcggcagctgagcagggagcttcgccttcagattctcatcatagacaacttcattcct
caggactaccaggaaatgattgagaactacgttcactggaatgaagacataggagagtgg
cagctgaagtgtgttgcatatacaggaaacaatatgaggaaacagacgcctgtcctggat
aaaaaagagaaagatccctttgaagtggacctttcccatgtttacttagcttacactgaa
gaaagcttgaggcaatctctgatgaagctggagaggccgaggacttcaaaaggaagatcc
aggcccaagactggtagaagaaaacgttcagccaagccaggagctgttattgattccctg
ctgcagtag

DBGET integrated database retrieval system