KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112448Help
Entry
102112448         CDS       T02921                                 

Gene name
RNPEP
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phi01002]
    102112448 (RNPEP)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     102112448 (RNPEP)
Peptidases and inhibitors [BR:phi01002]
 Metallo peptidases
  Family M1
   102112448 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 102112448
NCBI-ProteinID: XP_005530293
LinkDB All DBs
Position
Un
AA seq 635 aa AA seqDB search
MAAPVRDPAPVRDAASASSAGPWSLRHLHLELSVSFAAAGPGRLRGRARLELRCERAGAE
LRLDAHPALAVSRAALLPPPGGPGDAAGQALPVESRPFASYGSALHIALPQAPRAGQLLT
LLIDYEAGEGPGVCWLSPEQTAGKQKPYMYTQGQAVLNRSFFPCFDTPSVKFTYSATVKV
PEGFTAVMSATSWEKQKDNTFVFKMSQPIPSYLIALVVGDIVSADVGPRSRVWAEPCLIE
AAKKEYDGVIEEFLEVGEKLFGPYVWGRYDILFMPPSFPFGGMENPCLTFVTPCLLAGDR
SLVDVIIHEISHSWFGNLVTNATWGEFWLNEGFTMYAQRRISTEVYGLPYTCLEAATGRA
LLRQHMDATGEDHPLNKLRVVIEPGVNPDDTYNETPYEKGYCFVSYLAHLVGNQSKFDAF
LQAYVNRFKFQSITADDTLGFFLEYFPELKEKGVDSIPGFEFDRWLNVPGWPPYLPDLSP
GQQLMGPADELAELWAADGLNMEAIEAVDIMGWRTYQLVYFLDQVLQKSPLPEGNVERLS
KMYPKISKAQNAELRLRWCQIVLKNNLEAEYSKVKDFLHSQGKQKYTLPLYRAMWGGSEA
TRALAMEIFSATAPQLHVNVQNYVKKILGLGGGEA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccggtgcgggacccggccccggtgcgggacgcggcctctgccagcagcgcg
ggcccgtggtcgctgcggcacctgcacctggagctgagcgtgtccttcgcggccgcgggc
ccggggcggctgcggggccgagcgcggctggagctgcggtgcgagcgggccggagcggag
ctgaggctggacgcgcaccccgcgctggccgtgagccgcgccgcgctcctgccgccgccg
ggcgggcccggggacgcggccgggcaggcgctgcccgtggagagccggcccttcgccagc
tatggcagcgccctgcacatcgccctgccccaggccccccgtgccgggcagctgctcacc
ctcctcatcgactacgaggcgggcgaggggcccggggtgtgctggctgtcccctgagcag
acggcggggaagcagaagccctacatgtacacacagggccaggctgtgctcaacaggtcc
ttcttcccctgctttgacaccccttcagtcaagttcacctattcagccaccgtgaaggtc
cctgagggcttcacagctgtgatgagtgccacgagctgggagaagcagaaggataacacc
tttgtattcaagatgtcccagccaatcccctcctacctgattgctctggttgttggggac
atcgtgtctgctgatgttggcccaaggagccgcgtctgggccgagccctgcctgatcgag
gctgccaagaaggagtatgatggggtgattgaggagttcctggaggttggagagaaactc
tttggaccttatgtttggggcaggtatgacatcctgttcatgccgccctccttccccttt
ggtggcatggagaacccctgcctcaccttcgtcacgccgtgcctgctggccggggaccgc
tccttggtggacgtcatcatccatgagatctcccacagctggtttggcaacttggtcacc
aatgccacgtggggcgagttctggctgaacgagggcttcaccatgtacgcccagaggcgc
atctccaccgaggtctacggtttgccctacacctgcctggaggctgccacgggaagggcc
ctcctgcgccagcacatggacgccaccggggaggatcacccgctcaacaagctgcgggtg
gtgatcgagccaggtgtcaatccagatgacacgtacaacgaaacaccctatgagaaggga
tactgcttcgttagctacttggcccatcttgtgggcaaccagagcaagtttgacgccttc
ctccaggcctacgtgaaccggttcaagttccagagcatcactgcagatgacaccctcggg
ttcttcctggagtacttcccagagctgaaggagaaaggcgtggactccatcccagggttt
gaatttgaccgctggctgaacgtgccaggctggccgccctacctgcctgacctgtcgccg
gggcagcagctgatggggccggcggatgagctggcagagctctgggcagctgatggtttg
aacatggaggcgatcgaagccgtggacatcatgggctggaggacataccagctggtctat
ttcctggatcaggtcctgcagaaatcccccctgcctgaaggcaatgtggaaaggctgagc
aagatgtaccccaagatctccaaggcccagaacgctgagctgcgactgcgctggtgtcag
attgtcctcaagaacaacctggaggctgagtacagcaaagtcaaggacttcctgcacagc
cagggcaagcagaagtacacgctgcccctgtaccgtgccatgtggggtggctctgaggcc
acccgggccctggccatggagatcttctctgctacggccccccagctccacgtcaacgtc
cagaactatgtcaagaagatcctgggcttggggggtggtgaggcctga

DBGET integrated database retrieval system