KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112800
Entry
102112800         CDS       T02921                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04020  Calcium signaling pathway
phi04114  Oocyte meiosis
phi04140  Autophagy - animal
phi04261  Adrenergic signaling in cardiomyocytes
phi04270  Vascular smooth muscle contraction
phi04310  Wnt signaling pathway
phi04340  Hedgehog signaling pathway
phi04371  Apelin signaling pathway
phi04530  Tight junction
phi04540  Gap junction
phi04910  Insulin signaling pathway
phi04912  GnRH signaling pathway
phi04914  Progesterone-mediated oocyte maturation
phi04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102112800 (PRKACB)
   04310 Wnt signaling pathway
    102112800 (PRKACB)
   04340 Hedgehog signaling pathway
    102112800 (PRKACB)
   04371 Apelin signaling pathway
    102112800 (PRKACB)
   04020 Calcium signaling pathway
    102112800 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102112800 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102112800 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102112800 (PRKACB)
   04540 Gap junction
    102112800 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102112800 (PRKACB)
   04912 GnRH signaling pathway
    102112800 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102112800 (PRKACB)
   04916 Melanogenesis
    102112800 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102112800 (PRKACB)
   04270 Vascular smooth muscle contraction
    102112800 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102112800 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:phi03019]
    102112800 (PRKACB)
   03036 Chromosome and associated proteins [BR:phi03036]
    102112800 (PRKACB)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102112800 (PRKACB)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: AGC group
  PKA family
   102112800 (PRKACB)
Messenger RNA biogenesis [BR:phi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102112800 (PRKACB)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102112800 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102112800
NCBI-ProteinID: XP_005521080
LinkDB
Position
Un
AA seq 398 aa
MAGHKEVPCNQGTGTATALQRLEGFANRLFHRHSKNGAHEQKPALGNESQQCSEFTAQWD
ASMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagggcacaaggaggtcccttgtaaccagggcacggggacagccacggcgctgcag
agactggaagggttcgctaaccgcctcttccataggcactccaagaatggtgcgcatgag
cagaaaccggctctgggaaatgagagccaacagtgctctgagttcactgcccagtgggat
gcatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagcggcaaaaaacccttggaacagga
tcatttgggagagtaatgatggtgaaacataaatccacagaacagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcagatagaacacacactgaatgagaag
aggatattacaagcagtgaacttccctttccttgttaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggagaaatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcaacaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggcagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagcccattcaaatttacgagaagattgtgtct
ggaaaggtgaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggtcctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcttctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system