KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112903
Entry
102112903         CDS       T02921                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04080  Neuroactive ligand-receptor interaction
phi04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102112903 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102112903 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phi04030]
    102112903 (LPAR2)
G protein-coupled receptors [BR:phi04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102112903 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Rax2
Other DBs
NCBI-GeneID: 102112903
NCBI-ProteinID: XP_005533492
LinkDB
Position
Un
AA seq 337 aa
MKHCFYNETLGFFYNNSRKELSSHWRPKDVLVVALGLAVSAVVLLTNLLVIAAVATNRRF
HYPIYYLLANLAAADLFAGVAYMFLMFHTGPRTAQLSLKTWFIRQSLLDTSLTASVVNLL
AIAVERHRTVLTMQLHSEMSAQRVVGLIFSIWAAALLLGLIPSYGWHCLCSLESCSRMAP
LYSRSYLTFWAVSNLAVFLVMVVVYGHIFVYVRRRMARMARHTGAHPRHRDTVMALVKTV
TIVLGAFVVCWTPGQVLLLLDGLGCQSCDVLAVEKYVLLLAEINSLINAIVYSWRDNEMR
NTFRRILCFPCLRRSKYAAPERGLNSHNGHFTVDSSI
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaagcactgcttctacaacgagaccctcggcttcttctacaacaacagccgcaaggag
ctcagctcccactggcgccccaaggacgtcctggtggtggccctgggcctggcggtcagc
gccgtggtcctgctgaccaacctgctggtcatcgccgccgtggccaccaaccgccgcttc
cactaccccatctactacctcctggccaacctggccgccgccgacctcttcgccggcgtg
gcctacatgttcctcatgttccacaccgggcctagaaccgcccagttgtccctcaagact
tggttcatccggcagagcctgctggacaccagcctgaccgcttcggtggtcaacctgttg
gccatcgcggtggagcggcaccggacggtgttgaccatgcagctccacagcgagatgtcg
gcgcagcgcgtggtgggcttgatcttctccatctgggcggcggcgttgttgttggggttg
atcccgtcctacggttggcactgcctgtgctccttggagagctgttccaggatggcgccg
ctctacagccggagctacctgaccttctgggccgtgtccaacctggccgtgttcctggtg
atggttgtggtctacgggcacatcttcgtctacgtccgcaggaggatggcgcgcatggcg
cggcacacgggcgcgcacccgcggcaccgcgacaccgtcatggcgctggtcaagaccgtc
accatcgtgctgggcgctttcgtggtgtgctggacccctggccaggtcctgctcctcctg
gacgggctgggctgccagagctgcgacgtcctggccgtggagaaatacgtcctgctgctg
gccgaaattaactcgctaattaacgccatcgtttattcctggcgggataacgagatgagg
aacaccttccgccggatcctgtgcttcccgtgcctccgccgctccaaatacgccgcgccc
gagcgggggctgaattcccacaacggccacttcaccgtggattcttccatttag

DBGET integrated database retrieval system