KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113262
Entry
102113262         CDS       T02921                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04115  p53 signaling pathway
phi04140  Autophagy - animal
phi04141  Protein processing in endoplasmic reticulum
phi04210  Apoptosis
phi04217  Necroptosis
phi04261  Adrenergic signaling in cardiomyocytes
phi04340  Hedgehog signaling pathway
phi04510  Focal adhesion
phi04621  NOD-like receptor signaling pathway
phi05132  Salmonella infection
phi05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102113262 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102113262 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102113262 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102113262 (BCL2)
   04217 Necroptosis
    102113262 (BCL2)
   04115 p53 signaling pathway
    102113262 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102113262 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102113262 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102113262 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102113262 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102113262 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phi01009]
    102113262 (BCL2)
Protein phosphatases and associated proteins [BR:phi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102113262 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102113262
NCBI-ProteinID: XP_005526525
LinkDB
Position
Un
AA seq 234 aa
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLSPGLSAPAAAAGTSSDHTGLV
SPHPEPPGSAAASHTPPAEGQRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFT
ARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAAWMTEYLNRHL
HHWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 705 nt   +upstreamnt  +downstreamnt
atggctcatccggggagaagaggctatgataaccgggagatagtgctgaagtacatccac
tataaactctcccagaggggatacgactgggctgccggcgaggacagggcacccctgtct
ccaggtctctctgctcctgctgctgctgctgggacttcctctgatcacactgggctggtg
tctccgcaccccgagccccccggctcggctgctgctagccacacgcccccggccgagggg
cagcgccccgcaccccaggtcgtgcacctcgtcctgcgccaggcgggggatgagttctcc
cgacgctaccagagggactttgcccaaatgtctggccagctgcacctgacacccttcacg
gccaggagccgctttgtggccgtggtggaggagctcttccgagacggggttaactggggc
agaattgtggccttcttcgagtttggcggtgtgatgtgtgtggagagcgtcaaccgggag
atgtctcccctcgtggacaacattgctgcctggatgactgagtacctgaaccggcacctg
caccactggatccaggacaacggaggctgggatgcctttgtggagttgtatggcaacaat
atgaggcctttgttcgatttctcctggatctctctgaagactatcctgagtctggttctg
gtgggagcttgcatcactcttggcgcttatctcggacataagtag

DBGET integrated database retrieval system