KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113463Help
Entry
102113463         CDS       T02921                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04210  Apoptosis
phi04625  C-type lectin receptor signaling pathway
phi04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102113463 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102113463 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102113463 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102113463 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102113463 (MAP3K14)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102113463 (MAP3K14)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: STE group
  Other
   102113463 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 102113463
NCBI-ProteinID: XP_005532674
LinkDB All DBs
Position
Un
AA seq 938 aa AA seqDB search
MAVMGIECQGAPDPAIKHKKELTAAKGLKETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDHIPNNV
AHATEGRMAPTWRGRHRGRAKKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQEDE
SHQSTLYRNSFWVPEFNKDLGYDPLSLEKCAHAPLSTGKLHSPRSQYKTELHKLISPIQC
LNHVWKQRETVPQPETLHPFPYNILPPHFPLVDSPLHAMKHNALDTYFNGDLNYQDSRLS
GLNLEYNFTKYINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLELK
EQFHEANENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAA
KKVQVEHFRAEELTTCAAVTSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLP
EDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLGK
CLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKI
AKEPPPLREIPPSCNPLTAEIIKLGLEKEPLHRASASELKTKTCVALEEVGGVRSPWKGE
YREPRHLSLNKENSAQTSLSPTVSPVSETGSDPKLSVKVSCASPVPPPPSLEQTEEVEGS
HWNEGKELPETCDPPPLSSTPLPLKSCSHMERATTISEQELQQLEIELFLNSLSQPYSLE
EQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQADGQSCSWNNLLSRS
RHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQPV
RYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattgaatgccagggagctcctgatccagccatcaagcacaaaaag
gagctcacagctgccaaggggctgaaggagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgcccacagtaaacgttacagccgctcggacagcctcgatcacatccccaacaatgtg
gcccatgccacggagggcaggatggcgcccacctggcgagggaggcaccggggcagggcc
aagaagaaacggcacaagaaaagatccaagctgaaagggcaacctgtggctgctggcagg
agaagtccaagaactccagaacaggagagctgcaccccaattcctgtccaggaggatgaa
tcccaccaaagtactctttacagaaacagtttttgggttcctgaatttaacaaagacttg
ggctatgatccactgtctcttgagaagtgtgctcatgctcctttgtccacgggcaaactc
cattccccaaggagccaatacaaaactgaactgcacaagctgatcagccctattcagtgc
cttaatcatgtttggaaacagagggagactgttccccagcctgagactctccatcctttt
ccctacaatatccttcccccccatttcccacttgtggacagtcctctccatgccatgaag
cacaatgctctggacacatacttcaatggtgatctcaactatcaagacagtcgcttatct
ggcctaaacttagaatataatttcaccaaatacatcaaccagtccgtgcaaaccagttca
gacaagctttctgtggaagaatatttggtagatgccttgaaggggagcgtgagttttggt
gaaccacaaaatttagccagcctggccaagacgtggagaggaggtgggctggagctgaag
gaacaattccatgaagcgaatgaaaatgaaggcgtgctgctgaacgagaagttgaagcca
gtggattacgagtaccgagaagaggttcactggacaaagtgccatggttccttgggcatt
ggctcttttggggaagtgtacaagatagaggacaagcagacaggatttcagtgtgctgcc
aagaaggtgcaggtggaacacttccgtgccgaggagctgacgacatgcgcggctgtgacg
agccccagcgtggtacccctgtacggcgccgtcaaggagggcccctgggtcaccatcttc
atgaagctgatggagggtggctcattagggcagctcattaaacagagtggctgcctgcca
gaggacagagccctcagctacctgggccaggtgttagagggtctggagtatcttcatgct
caaaacattctccatggagatgtcaaagcggagaacgtgctgctgtcggacgatgggagc
agggccctcctgtgtgactttggccactctgctcacctgcacccagacgggctgggaaag
tgcttggtcacagggaactacgtgcctggcacagagacccacatggccccggaggtggtg
atggggaagcgctgtgactccaaggtggatgtgtggagcagctgctgtatgatgctgcac
atgctcaacggctgccacccctggacccagtactacaaccaccctctgtgcctgaagatc
gctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctcactgctgag
attattaagctggggctggagaaggagcctctgcacagggcatctgcatcagagctcaaa
actaagacctgtgtggcactcgaggaagtgggaggtgtgagaagcccctggaaaggtgaa
tacagagagcccagacatttatctttgaacaaagaaaacagtgcacagacatccctgtcc
cctacagtgagcccagtttctgagactggttctgacccaaaactgtcagtcaaagtttcc
tgtgccagcccagtcccaccacctccatctctggagcaaacagaggaggttgagggaagc
cactggaatgagggcaaggagttacctgagacctgtgaccccccacctctctcctcgact
cctctgcccctgaagagctgcagccacatggaaagagccacaaccatttcagagcaagaa
cttcagcagctggaaattgaactgtttctgaacagcctttcccagccttactctctggaa
gagcaagagcaaatgctttcatgcctcagcatcgacagcccctttgtgtcagatgccagt
gagaagaactctatgaaggcttctcacagcttgagggacaccatgagctctgggatccat
tcctggaacagccaggcagacgggcagagctgcagctggaacaacctgctgagccgcagc
cggcacacggatactcccagctacttcaacggagtgaaaatccagatccagttgctaagt
ggagaaaatttgcacatcagagatttccacaggacaaaggtgggagacattgccacaggc
ataagcagccagatccctgtgcctgccttcagcctggtgaccaaggaggggcagcctgtg
cgctatgacatggaggtgcccgactctggcatcgagctgcagtgcaccctggcccccgac
tgcagcgtcagctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system