KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113476
Entry
102113476         CDS       T02921                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04020  Calcium signaling pathway
phi04144  Endocytosis
phi04510  Focal adhesion
phi04540  Gap junction
phi04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102113476 (PDGFRA)
   04020 Calcium signaling pathway
    102113476 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102113476 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102113476 (PDGFRA)
   04540 Gap junction
    102113476 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102113476 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102113476 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:phi04090]
    102113476 (PDGFRA)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102113476 (PDGFRA)
Protein kinases [BR:phi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102113476 (PDGFRA)
CD molecules [BR:phi04090]
 Proteins
  102113476 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 102113476
NCBI-ProteinID: XP_005517769
LinkDB
Position
Un
AA seq 1087 aa
MGTSPQTFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGNHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPAVIPCRTSDPDAQVTLVNSLDKPMYALYDTKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccacagaccttcctgatcctgggatgttttctcacaggaccattccta
acattttgccagcttcctctgccaaccattgttcccaataggaatgaaatggtggtacag
ctgaattccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgactgagggaaaccacaggatagacattagacacgaagaaaacaacagtggcctcttc
gtgacagtgctcgaagtaggaaatgcctcggccgcccatacaggcttgtatgtttgctat
tataaccacacacaagtggaggacggggaagtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcctgcagttattccttgtcggacaagtgacccagatgctcaagtgacttta
gttaacagtttagacaagcccatgtatgctttatatgacaccaaacaaggcttcataggc
aattttcctgcgggctcgtacacatgcaaaacaatggttaaaggcgtggagttcaaatct
gacgagttcctcatctatattataagagctacttcacaactgcctgttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
ctcgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaaggctttgttcacctggagccccag
tttagccctctggaagctgtcaacctgcatgaagtcaaaaactttgttgttgatgtgcag
gcttatccagcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
acggagattgttactagttccaacagagtccaggaaacaaggtttcagagtattttaaaa
ttgatacgggccaaggaggaagacagtggatactatactttggtagctgaaaatgaagat
gaaattaaaagatacaccttctccttgctaatacaagttccagctctgatctcagctctt
gtggatgatcaccatggctctgcaggtgggcagacagtgagatgtttggcagaggggacc
ccacttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcttggacccttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaatatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgacctcggtgctgttactcgagagctgaagcttgtggctcccacc
ttgagatcagagctgacggtggctgctgccgtcttagtgctgttagtgattgtgataatt
tcactgattgtcctggtcatcatatggaaacagaagccaaggtatgagattagatggcga
gtcattgagtctatcagccctgatggccacgagtatatttatgtggacccaatgcaactg
ccttatgactccagatgggaatttcctcgagatgggttagtgcttggtcggatcctcggt
tctggtgcatttggaaaagtagttgaagggactgcatatggattgagtcgctctcaacca
gtgatgaaagtagctgtgaaaatgctgaaaccaacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcattactgaatactgtttttatggg
gatttggtgaactacctgcataagaatagggacaatttcctgaaccgacacccagaaaag
cctaaaaaagatttggatatctttgggatgaaccccgctgatgaaagcacaagaagttat
gtgatactatcatttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggctctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcatataagaagaaatccatgtcagaatcagaagtcaaaaac
cttctttcagatgacagttcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggct
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagtacttttctcccagtaaaa
tggatggcacctgaaagtatttttgacaacctgtacacaacgttaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccgaatggccaaaccagatcac
gctaccaatgaagtgtatgagattatggtgaagtgctggaacagtgaaccagagaaaaga
ccgtctttctaccatttgagtgaaattgtggagagcctgctgcctggagagtacaaaaag
agctatgagaagattcatctggacttcctgaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtaacttacaagaatgaagacaagctaaag
gacagggagagtggatttgatgagcagaggctgagtgctgacagtggatacatcattccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaagaaacagacacagttcg
cagacatctgaagaaagtgccattgaaactggttccagtagctctaccttcatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggattgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system