KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113603Help
Entry
102113603         CDS       T02921                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00052  Galactose metabolism
phi00500  Starch and sucrose metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102113603 (MGAM)
   00500 Starch and sucrose metabolism
    102113603 (MGAM)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102113603 (MGAM)
    3.2.1.20  alpha-glucosidase
     102113603 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102113603
NCBI-ProteinID: XP_014118010
LinkDB All DBs
Position
Un
AA seq 1887 aa AA seqDB search
MKIGSASGSSRGRPRPLNKKGRILDCSGISAQRGGKDPAPAPNSANKKNSPHHQEWVWNF
GEFTEFPKSRFSSNSWQMGQWSRLELALGALFLVAVAVAGVLLGILGTWDPKSRETRFSP
QCPNVSLAERLDCIPDHAATKSLCERRGCCWSPLSEPGVPWCFFSSEHGYRLESGPHTTS
QGLEVLLRRLPSPSLFGAAADLVRLRAQFQSSARLRLQFTDPEKQQFEVPHDHIGPFSGP
AASDPKYLLKFQENPFGIQVIRASTGKVIFDTTIGPLVFSEQFLQISTRIPSSNVYGLGE
HLHRSFRHDLHWKTWPLFSRHAAPSASVENLAGVHTFFLCLEDNSGASMGVFLMNSNAME
VALTPAPAVTFRTIGGILDFYIFLGDTPEQVVQEYVQFIGLPALPPYWALGFQLSHRSYG
SLDEVKAVVERNRAIGLPYDVQYTDIDAMDGCKDFTYDKIKFHDLPNFRKFLSAAEQKFV
IVLDAAIAMEPMADGSPYRTFERGQEKRVWVNESDGVTPLIGEARPGQVVFPDFSNPVCV
EWWEQEFQRFHELIPYDGIWIDMNEAACFIPGSTRGCTDSTWNFPPYTPRVADWPLFRRS
LCLDAVQSWGRQYDVHSLYGHSMALATLRALGRLSPGRRSFLVSGSTFAGSGRLGGHWLG
NNAATWDHLRWATPALLEFGLFGIPYVGAAICGSLGAAPEELCRRWMQLGAFYPLARNHN
HESSTPQDPAAFGANSVLVNSSRHYLSIRYHLLPYLYSLFYRAHTRGDTVARPLLHEFYA
EEATWDVNGQFLWGPGLLITPVLEPGVEVISAYIPDAVWYEYESGSRLWMRKQWTHLYLP
ADKLGLHLRGGHIFPVQHPATTTAASRRNPMGLIVALDENQEATGELFWDDGESADTVSS
KSYIFYNFWFSKTVLELSVAHNNLSEPHGLEFQELRVLGLRQAPLAITVTSSKATVPSPH
NLTYDAATQVTIVQGLRLRLGQSYSLRWTLGTRDSDRFDCHPAEGASRESCEHLGCIWNE
NTSGVRVPYCHYNGSDNGYSASDIRYSPTGATATVTLERHGHASTTAATIPIETLGLEVT
FHMDHLLQFKIYDPATQRYEVPVPLSLPGSPQASVQRRLYDVTIQERPFGVQVRRRSSGT
VIWDSQLPTFMFSDQFLQISTHLPAPFVFGFGETEHDAFRHNLDWHTWGMFTRDQPPGYK
LNSYGFQPFYMGLEKDGNAHGVLLLNSNAMDVTFQPTPALTYRTVGGILDFYLVLGPTPE
EVVQEYTELVGRPVMPAYWALGFQLCRYGYENDAEIAQLVNDMNRAQIPLDVQYADIDYM
ERQLDFTLSPRFQGLPELVRRIQSNGMRFILILDPAISANETNYPAYDRGMQQDVFIKWP
DSDDLVYAKVWPDLPNVVVNDSLDWDTQVELYRAFAAMPDFFRNSTKDWWAQEIAEVYEN
PRNSSLSIKFDGLWIDMNEPSSFVHGTIGGCRDQNLNFPPYMPQLGSRSEGLSFKTICME
GQQQLPDGSPVRHYDVHNLYGWAQTKPTLDILRNLTGERGIVVTRSTFPSSGRWAGHWLG
DNTAAWNQLDKSIIGMMEFSLFGISYSGADICGFFGEPSYELCARWMELGAFYPYSRNHN
GNKAKRQDPVAWNSTFADLSRAVLQLRYRLLPHLYTLMFHAHVRGSTVVRPLLHEFVEDR
ITWDIYRQFMWGAGLLISPVLEPGVSEVRAYLPDARWFNFHTDEEVVFRHQFQNFPAPLG
HINLHVRGGHILPQQLPANNTWFSRQNPLLLTVALDDAQEASGNLYWDDGVGIDTFEKGE
YLMMSFTASSNILELRVLHGGYMDPNSLKFTEIKVLGVPGSVQEVTVTRNGLDVQSPHAV
AHDPQKQVLKITQLELELGQNYTLKWT
NT seq 5664 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggatctgcttcgggcagttcccggggcaggccccgccccctgaataaaaag
gggagaattctggactgttctgggatttcggcccaacggggagggaaagatccggctcca
gctccaaattccgccaacaagaaaaattctccccatcaccaggagtgggtgtggaatttt
ggggaattcacggaattcccaaaatcccgtttttcctccaattcctggcagatggggcag
tggagccgcctggagctggcgctgggggcgctgttcctggtggcagtggccgtggccgga
gtgctgctgggcatcctggggacgtgggaccccaaatcccgggaaacccgtttttcccct
cagtgcccaaatgtatccctggctgagcgcctcgactgcatccctgaccatgcagccacc
aagagtctgtgtgaacggcgcggctgctgctggagcccgctcagcgagcccggggtgccc
tggtgtttcttctcctctgagcacggctaccggctggagagcggcccccacaccacgagc
cagggcctcgaggtgctcctgcgccggctcccgtccccgtcactcttcggggcagccgcg
gacctcgtgcggctccgggcgcagttccagagctccgcgcggctccgcctgcagttcacc
gaccccgaaaagcagcagtttgaggtcccccacgaccacattgggcccttttctggcccc
gctgcctctgaccccaaatatctgctgaaattccaggaaaatccctttgggatccaggtt
atccgagccagcaccggcaaagtcatattcgacaccaccatcggccccttggtgttttcc
gagcaattcctgcagatttccacccgaattcccagctccaacgtctatggcctgggggag
catctccaccggagcttccggcacgatctgcactggaaaacctggcccctcttcagccgc
cacgccgccccctctgctagtgtggagaacttggccggagtacatacatttttcctctgt
ttggaagacaattctggagcttccatgggtgttttcctgatgaacagcaatgccatggag
gtggcactgactccggctcccgccgtcactttccggacaattggaggaatcttggatttt
tacatctttttgggggacacacccgagcaggtggtgcaggaatatgtacagtttattggg
ctgcccgccctcccaccgtattgggcactgggattccagctcagccaccgcagttacgga
tccctggatgaggtgaaggctgtggtggagcggaaccgggcaattgggctgccctatgat
gtgcagtacactgacatcgatgccatggacgggtgcaaggatttcacctacgacaaaatc
aaattccacgatcttcccaatttccgcaaattcctgagtgccgctgagcagaaattcgtc
attgtcctggatgctgccatcgccatggagccaatggcagacgggagcccctacaggacc
ttcgagagaggccaggagaaacgggtgtgggtcaacgagtctgatggcgtcacaccgcta
attggggaggcacggccaggccaggtggttttcccagatttctccaaccccgtgtgtgtg
gagtggtgggagcaggaattccaaagattccatgagctcatcccctacgacggcatctgg
atcgacatgaacgaggctgcatgcttcatccctggctccaccagaggctgcactgacagc
acatggaactttcccccctacaccccccgtgtggctgactggccgctcttcagacggtca
ctctgcctggatgctgtccagtcctggggccggcagtatgacgtgcacagcctgtacggc
cactccatggcactggcaacgctccgggctctaggccggctgtccccagggcgccgcagc
ttcctggtgtctggctcaacctttgcgggctccggacgcctcggtggccactggctcggg
aacaatgcagccacctgggaccatctgcgatgggctacccctgctctgctggaatttggc
ctctttgggatcccctatgtgggggctgccatctgtgggtccttgggggcagctccggag
gaactttgccggcgctggatgcagcttggggccttttatcccttagccaggaaccacaac
cacgaaagcagcacaccacaggatccagctgcattcggtgccaactcggtgctggtgaac
tcatcccgacactacctgagcatccggtaccacctgttgccctacctgtattcactgttc
taccgtgcccacacccgtggagataccgtggctcgaccactgctgcatgagttttacgct
gaggaggccacatgggacgtgaatgggcagttcctgtggggtccagggctcctcatcacc
cctgtgctcgagcctggtgtggaggtgatctcggcttacattcccgatgctgtctggtat
gagtacgagtcgggctccaggctgtggatgcggaagcagtggactcacctgtacctgcct
gcagataagctggggctgcacctgcgcgggggccacatcttccctgtgcagcacccggcc
accaccacagctgccagccgcaggaatcccatggggctcatcgtggcactggatgagaac
caggaggcaacgggggagcttttttgggatgacggagaatctgcagatactgtgagcagc
aaatcatacattttctacaacttctggttttccaaaactgtgctggagctgtcagtggcc
cacaacaacctctcagagcctcacgggctggagttccaggaactgcgcgtgctggggcta
cggcaggcgccactggccatcaccgtgacatccagcaaagccactgtcccatcaccccac
aatctcacctatgacgctgccacacaggtcaccatagtccaggggttgcggctgcgcctc
ggtcaatcctacagcctgcgctggacactggggacacgcgacagtgaccgctttgattgt
catcccgccgagggtgcgtcccgtgagagttgtgagcaccttggctgcatctggaatgaa
aatacctcaggcgtccgtgtcccctactgccactacaacggctccgataacggttactct
gcctcggacatcaggtactcacccaccggagccacagccaccgtgaccctagagcgccat
ggccatgccagtaccactgcagccaccatacccattgagaccctgggcctggaggtgacc
ttccacatggaccacctgctgcagttcaagatttacgaccctgccactcagcggtacgag
gttccagtgccactctcactcccgggcagcccccaggcctcagtccagcgccgcctctat
gatgtcaccatccaggagcgaccctttggggtccaggtgcggcgccgcagcagtggcact
gtcatctgggactcacagctgccgacattcatgttcagtgaccaattcctgcagatctcc
acacacctcccagcaccgtttgtgtttggcttcggcgagactgagcatgacgccttccgc
cacaacctggactggcacacctggggcatgttcactcgcgaccagcccccaggctacaag
ctgaattcctatggtttccaacctttctacatggggctggaaaaggatggcaatgctcac
ggtgtcctgctgctcaacagtaacgccatggatgtcactttccagccaaccccagccctc
acctaccgcactgttggtggcattctggatttctatctggtcctagggccaactcctgag
gaagtggtgcaggaatacacagagctggtgggacgcccagtaatgcctgcctattgggcc
ctgggcttccaactctgccgctatggctatgaaaacgatgccgaaattgcccaattggtc
aatgacatgaaccgagcccagatccctctggatgtgcagtatgctgacatcgattacatg
gagcgccagctggacttcacactcagcccacgcttccaggggctcccagagctcgtgcgg
cgcatccagagcaatgggatgcgcttcatcctcattctggacccagccatctcagccaac
gagactaattacccggcctatgatcgtggcatgcagcaggatgtcttcatcaagtggccc
gacagtgatgaccttgtctacgccaaggtgtggccggacctgcccaacgtggtggtcaat
gattccctggattgggacacccaagtggagctgtatcgggcctttgctgccatgccagat
tttttccggaactccaccaaggattggtgggcacaggaaattgctgaagtctacgaaaac
ccccggaactcctccctcagcatcaaattcgatggactctggatcgacatgaatgagccc
tcaagctttgtccatggcaccatcggcggctgccgggaccagaacctcaacttcccaccc
tacatgccccaattgggatcccgatctgagggcctgagcttcaaaaccatctgcatggag
gggcagcagcagctgccagacgggtcgcccgtacgccactatgacgtccacaacctctac
gggtgggcgcagaccaaacccaccttggacatcctgcggaacctcacaggggagcgtggg
atagttgtcacacgctcaaccttccccagcagcgggaggtgggcggggcactggctgggg
gacaacacagctgcctggaaccagctggacaaatccatcattggaatgatggaattcagc
ctctttgggatctcttatagtggggccgatatttgtggatttttcggggagccctcatat
gaactctgcgcccgctggatggagctcggtgccttctatccctattcccgcaaccacaat
gggaacaaggccaagcgccaggaccccgtggcctggaattccactttcgcggatctgtcc
cgggccgtgctccagctccggtaccggctcctgccccacctgtacacactgatgttccac
gcccatgtccgtggcagcactgtggtgcggcccctcctgcatgagtttgtggaggacaga
attacgtgggacatttacaggcagttcatgtggggggcgggtctgctcatcagccctgtc
ctggagccgggtgtatccgaggtgcgtgcatatctgcctgatgcccgctggttcaatttc
cacactgacgaggaggttgtattccgtcaccagttccagaactttccagcacccctgggc
cacatcaacctccatgtgcggggaggccacatcctcccccagcagctcccagccaacaac
acttggttcagccgccagaacccgctgctcctgactgttgctctggacgacgcccaggag
gcctcggggaacctctactgggatgatggcgtgggcatcgacacttttgagaagggcgag
tacctgatgatgtcgttcaccgccagctctaacattctggagctgcgggtgctgcacggg
gggtacatggacccaaattccctgaaattcacagaaatcaaggtgctgggggtccctggg
agcgtccaggaggtgacagtgacacgcaatgggcttgatgtccagtcccctcatgccgtg
gcccatgacccccaaaaacaggtgctgaaaatcacccaactggagctggagctgggtcag
aactacaccctgaaatggacctaa

DBGET integrated database retrieval system