KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113899
Entry
102113899         CDS       T02921                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04210  Apoptosis
phi04620  Toll-like receptor signaling pathway
phi04621  NOD-like receptor signaling pathway
phi04622  RIG-I-like receptor signaling pathway
phi04623  Cytosolic DNA-sensing pathway
phi04625  C-type lectin receptor signaling pathway
phi04920  Adipocytokine signaling pathway
phi05132  Salmonella infection
phi05164  Influenza A
phi05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102113899 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102113899 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102113899 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102113899 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102113899 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102113899 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102113899 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102113899 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102113899 (IKBKG)
  09172 Infectious disease: viral
   05164 Influenza A
    102113899 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102113899 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102113899 (IKBKG)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102113899 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO TPD52 DUF1192
Other DBs
NCBI-GeneID: 102113899
NCBI-ProteinID: XP_014117335
LinkDB
Position
Un
AA seq 500 aa
MSGGRWRRPAEMVQPGPEADPALAEALQRLRAENRELRGALCHCTESLRQRLEELRKLQL
QRRGERELLRGRWGQARDLVLHLRGQRRDSTGDTPGDSGDTPGDAKDTPGDAKDTPGDSK
DTPGDVWDAKDTPGDIRDTLRDTRDISRDTPDTSTKPPEAPPCSVSLPLEDVPAVPEPPQ
APSSTPLEPSSEEQLKQRLAEAEAELVTLRARVAVAELRAQDVSRAAELQLQGLRRQLEQ
DKAQVQAQVTSLLGELRESQNRLERSRAEREHLERRARSDAERCQQLEEVTQGHQVQLDQ
LRLQVTNLETALRVERRGATEEKRKLVQLQAAYHHLFQEYDAHIKASLEGDKRSQVTQEQ
LRAAEAALALKQDLIDHLKAEAERQRAALETIPVLQAQADIYRADFEAERAAREQLHGQR
EALQEELNQLRLHLGGDGARARLEEMRNRHSEPPPAPVPGRGFGGLLPPAEEGPDLCCPK
CQYKAPDMDTLQIHVMDCIK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgagcggcgggcgctggcggcggcccgcggagatggtgcagccggggcccgaagcggat
ccggcgctggcggaggcgctgcagcggctgcgggcggagaaccgcgagctaaggggtgct
ctgtgtcactgcaccgagtcgctccggcagcgcctggaggagctgcggaagctgcagctg
cagcgccggggggagcgggagctgctgcggggacgttggggacaggcccgggacctggtg
ctgcacttgcggggacagcgcagggacagcaccggggacacccccggggacagcggggac
acccctggggacgccaaggacacccctggggacgccaaggacacccctggggactccaag
gacacccctggggacgtctgggacgccaaggacacgcctggggacatcagggacaccctc
agggacactcgggacatctccagggacacccctgacaccagcaccaagccccccgaggcc
cccccctgctccgtgtctctcccccttgaggacgtccctgctgtcccggagcccccccag
gccccctccagcacccccctggagcccagttctgaggagcagctgaagcagcgcctggca
gaggctgaggctgagctggtgacactgcgggcacgtgtggccgtggccgagctccgggct
caggacgtttcccgcgcagctgagctgcagctgcagggcctgcgccgccagcttgagcag
gacaaggctcaggtgcaggcccaggtgacgtcgctgctgggggagctccgggagagccaa
aatcggctggagcggagccgggcagagcgggagcacctggagcgcagggcccgcagtgat
gccgagcggtgccagcagctggaagaggtgacccagggccaccaggtgcagctagaccag
cttcggctccaggtgaccaacctggaaactgccctgagggtggagcggcgtggggccacc
gaggagaagcggaagctggtgcagctgcaggccgcgtaccatcacctgttccaggagtac
gacgcccacatcaaggccagcctggagggggacaaacggagccaggtgacgcaggagcag
ctccgggcggccgaggccgcgctggccctcaagcaggacctgattgatcacctcaaggcc
gaggccgagcgccagcgggcggccttggagaccatcccggtgctgcaggcccaggccgac
atctacagggcggattttgaggcggagcgcgcggcgcgggagcagctgcacgggcagagg
gaggcgctgcaggaggagctgaaccagctgcggctgcaccttggcggggatggggcccgg
gcccgtctggaggagatgcggaaccggcactcggagccacccccggcaccggtcccagga
aggggttttggggggctcctgccccccgctgaggaagggcccgacctgtgctgccccaag
tgccagtacaaggctccggacatggacacgctgcagatccatgtcatggattgcatcaag
tga

DBGET integrated database retrieval system