KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113904
Entry
102113904         CDS       T02921                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04141  Protein processing in endoplasmic reticulum
phi04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102113904 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102113904 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phi03000]
    102113904 (ATF6B)
Transcription factors [BR:phi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102113904 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 102113904
NCBI-ProteinID: XP_014118278
LinkDB
Position
Un
AA seq 487 aa
MAALAPELLVQLDPGRFRADNLLGAEDWDDALYGCLDDRLDPAHLFPSLEPDPLVSHAHF
VQTPPVLGGVVSRPRPPRGEGSPKIRPFPSPSSIPDPPWHPEPPRACPDLQVKSEPDSPT
SSHCSDSSCASEPPIWVKSEPDSPTSSHCSDSSCASEPPIWAPSPPEMGVKPEPPPPLPC
VRAARRQQRMIKNRESASASRRRRKEYLQGLERRLHLALAENDRLRRDNGALRRRLQELL
GQPAPPPPVPGSRKLACVGALLLLLAFHLSPTSLPRPGAPPPPGGRGRRHLLGVQESGTP
PPPRFGEEPPARGAWPRAGEGFRNSSLASMSPWDPQKPRGTPECLRFNRTESLRYRGGFW
GFQGASPWKGLVPAEPPRTERAPPGQLQLYRGPDPPEPRILAAIDRRDDTFYVVSFRRDH
LLLPARSHNKTSRPKMSLVMPAAALNDSLRGLQAMMQVDCEVIDTRVIHVRRRRAPPTAR
ATPPHRP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcggcgctggcgccggagctgctggtgcagctggacccggggaggttccgggctgac
aatttgctgggggccgaggattgggatgacgccctttacggttgccttgacgaccgcctt
gaccccgcccacctcttcccctccctggagcccgaccccttggtaagccacgcccacttc
gttcaaaccccgcccgttttggggggcgtggtttcgaggccacgcccaccccggggggag
gggtcccccaaaatccgcccgttcccctcccccagctcgatccccgaccccccctggcac
ccggagcccccccgggcctgccccgatctgcaggtgaaatcggagccggactcgccgacc
tcctcccactgctccgactcctcctgcgcctccgagcccccgatttgggtgaaatcggag
ccggactcgccgacctcctcccactgctccgactcctcctgcgcctccgagcccccgatt
tgggcccccagcccccccgagatgggggtgaagccggagccccctccccccctgccctgc
gtgcgcgcggcgcggcggcagcagcgcatgatcaagaaccgcgagtcggcgagcgcgtcg
cggcgccggcgcaaggaatacctgcaggggctggagcggcggctgcacctggcgctggcc
gagaacgaccggctcaggagggacaacggggccctcaggaggagactgcaggagctgctg
ggacagcccgcccctcccccccccgtacctggcagccggaagttggcgtgtgtgggggcg
ctgctgctgctgctggcctttcacctgagcccaaccagcctcccccggcccggagcccct
cccccacccggggggaggggccggcgccacctgttgggggtgcaggagtcggggacccct
cccccaccccgctttggggaggagcccccggcgcggggggcgtggccgagggcaggggag
gggttcaggaactcctcgctggcctcgatgtccccctgggacccccaaaagccccggggg
acccccgagtgtctccgcttcaaccgcaccgagtccctgcggtaccgggggggcttttgg
gggtttcagggcgcgtccccctggaaggggctggtcccggctgagcccccccggactgag
agggcccccccggggcagctccagctctaccgaggccccgacccccccgaaccccgaatt
ttggccgccatcgaccgcagggacgacactttctacgtggtctccttccgaagggatcat
ctcctgctccctgcccggagccacaacaaaacctcgcgacccaaaatgtccctggtgatg
ccggcggcggcgctcaacgactccctgcgggggctgcaggccatgatgcaggtggactgc
gaggtgattgacacgcgcgtcatccacgtgcggcgccgccgggccccgcccaccgcgcgg
gccacgccccctcaccgcccctga

DBGET integrated database retrieval system