KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114193Help
Entry
102114193         CDS       T02921                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102114193 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank_2 DUF3454 Ank NOD NODP Ank_5 Ank_3 Ank_4 cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 102114193
NCBI-ProteinID: XP_005529261
LinkDB All DBs
Position
Un
AA seq 2555 aa AA seqDB search
MERLLAPGLLVLLLPALTRGLRCSQLAESCLNGGKCETFPNGTEVCQCSGAYVGERCQLP
NPCLSSPCKNAGTCTAVVRGSTVDYTCACRLGFTDELCLTPRDNVCLSNPCRNGGTCDLL
TLSEYKCRCPPGWSGKTCQQADPCASNPCANGGQCVPFEAHYICRCTAGFHGANCKQDVN
ECNISPPVCKNGGSCTNEVGTYQCSCKPAYTGQNCEHLYVPCNPSPCQNGGTCRQIGDTT
YDCTCLPGFTGQNCEENINDCPGNNCKNGGTCVDGVNTYNCQCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNNHGGYNCVCVNGWTGEDCSENIDDCAMAACFHGATCHDRVASFYCE
CPHGRTGLLCHLDDACISNPCNEGSNCDTNPVNGKAICTCPSGYMGPACNQDVDECSLGA
NPCEHAGKCINTQGSFQCQCLQGYSGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGNCLDKINEFHCECPTGFNGHLCQFDIDECASTPCKNG
AKCVDGPNTYSCECTEGFTGAHCEIDIDECDPDPCHYGTCKDGIASFTCLCQPGYTGHRC
DININECQSQPCKNGGTCQDRNNAYNCICLKGTTGPNCEINLDDCASNPCDYGKCIDKIN
GYECTCEPGYTGRMCNINIDECASNPCHNGGTCKDGINGFTCLCPEGFHDPKCLSEVNEC
NSNPCIHGKCHDGLNGYKCDCDPGWSGTNCDINNNECESNPCMNGGTCKDMTSGYICTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYTCNCLLPYTGATCEDVLAPCAGSPCKN
GGECQESEDYKSFSCSCPPGWQGQTCEIDINECVKSPCRNGATCQNTNGSYRCACRTGFS
GRNCDTDIDDCKPNPCHNGGSCSDGIGTFFCECLAGFRGPKCEEDINECASNPCKNGANC
TDCVNSYTCTCPSGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCVCLPGFTGSYCEH
NINECDSKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTSNL
YHCECNSGWTGLYCDVPSVSCEVAAKQQGIDVAHLCRNSGLCVDTGNTHFCRCQAGYTGS
YCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCQNGGTCID
LINTYKCSCPRGTQGVHCEINVDDCSPFFDPVTLGPKCFNNGKCKDRVGGYSCICPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDYKCECRPGYAGRRCDTVVDGCKGKPCRNGG
TCAVASNTGRGFICKCPPGFVGATCENDSRTCGNLHCLNGGTCISIHKSSKCMCTPAFTG
PECQYPASSPCTSNPCYNGGTCEFFSDASPYYRCNCPANFNGLNCHILDFDFQGGIGQDI
IPPKIEEKCEIAVCAGYAGNKICDGKCNNHACGWDGGDCSLNFNDPWKNCSQSLQCWKYF
NDGKCDSQCNNAGCLYDGFDCQKYEGQCNPLYDQYCKDHFSDGHCDQGCNNFECEWDGLD
CANNMPEKLADGTLVVVVLITPENLKNNSFNFLRELSRVLHTNVVFKKNPKGEYMIFPYY
GNEEELKKHYIKRSTEDWSDMSSAVINKVKSSLYSRAGRRQKRELDQMDIRGSIVYLEID
NRQCIQSSSQCFQSATDVAAFLGALASLGNLNIPYKIEAVKSETAEPTKNSQLYPMYVVG
AALVLVAFIGLGVLVSRKRRREHGQLWFPEGFKVTESSKKKRREPLGEDSVGLKPLKNAS
DGTLMDDNQNEWGDEETLDTKKFRFEEQAMLPDTDDQTDHRQWTQQHLDAADLRISSMAP
TPPQGEIDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEDDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLDDLINCHADVNAVDDLGKSALHWAAAVNN
VEAAMVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPTLHNGPLGAPTLSPPLCSPNSYIGNLKPAVQGKKARKP
STKGLSCNGKDAKDLKARRKKSQDGKGCLLDNSSVLSPVDSLESPHGYLSDVASPPLMTS
PFQQSPSMPLNHLPGMPDAHLSINHLNMAGKQDMAMGSSSRMGFDSVPPRLSHLPVSSPS
TGMSSAPMSFSVGGGAGLNGQCDWLTRLQNGMVQSQYNPLRANLQPGAHQQPQNLQHGMM
TSLHNGLPTTSLSQMMSYQAMPNTRLASQPHLMQSQQLQQMQQQQQQQLQQPNLQPPQQQ
PQQPQQPPQPPQQPQQQHHNPGSNGSGHMGQNFLGTELSQPDLQPVSGSAMAVHTILPQD
SQMLPTSLPSSLAQPMTTTQFLTPPSQHSYSSPLDNTPSHQLQVPDHPFLTPSPESPDQW
SSSSPHSNVSDWSEGISSPPTSMQSQMGHIPEAFK
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atggagcggctcctggcgcccggcctcctggtgctcctgctgcccgccctgacgcgaggt
ttacggtgctcgcagcttgccgaatcctgcctcaacgggggcaagtgtgaaacttttccc
aacgggacggaggtgtgccagtgtagcggtgcctacgtgggcgagcggtgccagctgccc
aacccctgcctgagctccccctgcaagaacgcgggcacctgcacggcggtggtgcgcggc
agcaccgtggattacacctgcgcctgccgcctgggcttcaccgacgagctgtgcctgacg
ccccgcgacaacgtgtgcctcagcaacccctgccgcaacggcggcacctgcgacctgctg
acgctcagcgagtacaagtgccgctgcccacccggctggtcaggcaaaacctgccagcag
gccgacccctgtgcctccaacccctgcgccaacgggggccagtgcgtgcccttcgaagcc
cactacatctgccgctgcaccgccggcttccacggcgccaactgcaagcaggacgtcaac
gagtgcaacatctccccgcccgtctgcaagaacgggggcagctgcaccaacgaggtgggc
acgtaccagtgttcctgcaagccagcctacaccgggcagaactgcgagcacctctacgtg
ccctgcaacccctcgccctgccagaacgggggcacctgccgccagatcggggacaccacc
tacgactgcacctgcctgccagggttcacgggtcagaactgtgaggagaacatcaacgac
tgtccgggcaacaactgcaagaatgggggcacctgcgtggacggcgtcaacacctacaac
tgccagtgcccacctgagtggacaggtcagtactgcactgaggatgtggatgagtgccag
ctgatgcccaacgcctgccagaacggtggcacctgccacaacaaccacggcggctacaac
tgcgtctgtgtcaacggctggacgggcgaggactgcagtgagaacatcgatgactgcgcc
atggccgcctgcttccacggggccacctgccacgaccgggtggcctccttctactgcgag
tgcccccatggccgcacaggtttgctctgccacctggatgacgcctgcatcagcaacccc
tgcaacgagggttccaactgcgacaccaaccccgtcaatggcaaagccatctgcacgtgt
ccttcggggtacatggggccggcctgcaaccaggacgtggatgagtgctcgctgggagcc
aacccatgtgagcacgcggggaagtgcatcaacacccaagggtccttccagtgccagtgt
ctgcagggctactcaggccctcgctgtgagattgatgtcaatgagtgcctctccaacccc
tgccagaatgatgccacctgcctggaccagattggggagttccagtgcatctgcatgcct
gggtacgagggggtttactgcgagatcaacacggacgagtgcgccagcagcccctgcctg
cacaacggcaactgcctcgacaagatcaacgagttccactgcgagtgccccactggcttc
aacgggcacctgtgccagtttgacatcgatgagtgtgccagcacgccctgcaagaatggt
gccaagtgcgtggatggccccaacacctacagctgcgagtgcactgaaggtttcacgggc
gctcactgtgagatcgatattgatgagtgtgaccctgacccgtgccattacgggacctgc
aaggacggcatcgcctccttcacctgcctctgccaacctggctacacgggccaccgctgt
gacatcaacatcaacgagtgccagagccagccctgcaaaaatggggggacctgccaggac
aggaacaacgcctacaactgcatctgcctcaaagggaccacgggccccaactgcgagatc
aacctggatgactgtgccagcaacccctgcgactacggcaagtgcatcgacaagatcaat
ggctacgagtgcacctgcgagccagggtacacagggcgcatgtgcaacatcaacattgac
gagtgtgccagcaacccctgccacaacgggggcacgtgcaaggacggcatcaacggcttc
acctgcctgtgccccgagggcttccacgaccccaagtgcctgtcagaagtgaacgagtgc
aacagcaacccctgcatccacgggaaatgccacgatggattgaatggctacaagtgtgac
tgtgaccctggctggagtgggacaaactgtgacattaacaacaacgagtgtgaatccaat
ccctgcatgaacggtggcacctgcaaggacatgaccagtggctacatctgcacctgcagg
gagggcttcagtggccccaactgccagaccaatatcaacgaatgtgcttccaacccctgc
ctgaaccagggcacgtgcattgatgatgttgctggctacacctgcaactgcctcctgccc
tacacaggagccacctgtgaggatgtgctggctccctgtgctggcagcccctgcaagaac
ggtggcgagtgccaggagtcagaggactacaagagcttctcctgcagttgcccccctggc
tggcaaggtcagacctgtgagattgacatcaatgagtgtgtgaagagcccctgcaggaat
ggggccacgtgccagaacaccaatgggagctaccgctgcgcctgccggactggcttctcc
ggccgcaactgcgacaccgacatcgacgactgcaagcccaatccgtgccacaacggtggc
tcctgctctgatggcattggcacgttcttctgcgagtgcctggctggtttccgagggccc
aagtgcgaggaggacatcaatgagtgcgccagcaacccctgcaagaacggggccaactgc
actgactgcgtcaacagctacacctgcacctgcccctccggcttcagcggcatccactgc
gagaacaacacccctgactgcaccgagagctcctgcttcaacggtgggacctgcgtggat
ggcatcaacaccttcacctgcgtctgcctgcccggcttcacgggcagctactgcgagcac
aacatcaacgagtgcgactccaagccatgcctgaatgggggcacgtgtcaggacagctac
gggacgtacaagtgcacctgtccccaggggtacaccgggctcaactgccagaacctggtg
cgttggtgtgactcctcaccctgcaagaacggaggcaagtgctggcagaccagcaacctg
taccactgcgagtgcaacagcggctggacagggctctactgtgatgtccccagtgtgtcc
tgcgaggtggctgctaagcagcaaggtatcgatgtagcacatctctgcaggaactcgggt
ctctgtgttgacactggcaacacacatttctgccgctgccaagccggctacaccggcagc
tactgtgaggagcaggtggatgaatgctctcccaacccctgccagaacggagccacctgc
acagactacctgggaggctactcctgcgagtgtgtggctggttatcatggagttaactgc
tcagaggagatcaatgagtgcttgtcccacccatgccagaatggaggaacctgcatcgat
ctcatcaatacctacaaatgctcctgccccagaggaactcaaggggtgcactgtgagatc
aatgtggatgactgcagccctttctttgatcctgtcaccctggggcccaagtgctttaac
aatggcaagtgcaaggatcgggtaggtggctacagctgcatctgcccccctggctttgta
ggggagcgctgcgagggagatgtcaacgagtgcctgtccaacccctgcgacgcccgcggc
acccagaactgcgtgcagcgggtcaacgactacaaatgcgagtgccgacctggctatgca
ggccgtcgctgtgacaccgtggtggatggctgcaaaggcaaaccctgcaggaatggggga
acctgtgctgttgccagcaacaccggccgtggcttcatctgcaagtgccccccgggattt
gtgggtgccacctgcgagaatgactcccgcacctgtgggaacctgcactgcctgaacggt
ggcacctgcatctccatccacaagagctccaaatgcatgtgcacgccggccttcacgggc
cccgagtgccagtacccggccagcagcccctgcacctccaacccctgctacaacgggggc
acctgcgagttcttcagcgacgcctccccctactaccgctgcaactgccccgccaacttc
aacggcctcaactgccacatcctcgacttcgacttccaggggggcatcgggcaggacatc
atcccccccaaaatcgaggagaagtgcgagatcgcggtgtgcgcggggtacgccggcaac
aagatctgcgacgggaaatgcaacaaccacgcctgcggctgggacgggggcgactgctcc
ctcaacttcaacgacccctggaagaactgctcccagtctctgcagtgctggaagtatttc
aacgatggcaagtgtgactctcagtgcaataatgctggctgcctctacgatgggtttgac
tgccagaaatatgaggggcagtgcaaccctctgtatgaccagtactgcaaagatcacttc
tcggatggtcactgtgaccagggctgcaacaattttgagtgcgagtgggatggtctggac
tgtgcaaacaacatgccagagaagttggcagatggcacgctggtggtggtggtcctcatc
accccagagaacctcaagaacaactccttcaacttcctgcgggagctgagccgtgtgctg
cacaccaacgtggtcttcaagaagaaccccaagggggagtatatgatcttcccgtactac
ggcaatgaggaggagctgaaaaaacattacatcaaaagatccacagaggactggtcagat
atgtccagtgctgtcatcaacaaagtgaagagcagcctctactccagggctggcaggagg
cagaagagggagctcgaccagatggacatcagaggatccatcgtctacctggaaattgat
aaccgccagtgcatccagtcatcttcccagtgcttccagagtgccactgatgtggcagca
ttcctgggagccttggcctcccttgggaacctcaacataccctacaaaatagaagctgtc
aaaagtgaaacagccgagcccacgaagaactcccagctgtatcctatgtacgtggtgggg
gctgcgctggtcttggtcgccttcatcggactgggagtgctggtgtctcgcaagcgccgc
agggagcatgggcagctttggttccctgaaggtttcaaagtgacagagtcgagcaagaag
aagcgacgggagcccctcggggaggattctgttggactgaaacccctcaaaaatgcttcg
gacggcacactgatggatgacaaccagaatgagtggggtgatgaggagaccttggacacc
aaaaagttcaggttcgaggagcaggcgatgctgccggacacggatgaccagacggatcac
aggcagtggacgcagcagcacctggacgccgctgacctgcgcatttcctccatggccccc
acgcctccacagggggaaatcgatgctgactgcatggatgtcaacgtcagagggccggat
ggcttcacccccctgatgatcgcctcatgcagcggaggagggctggagaccggcaacagc
gaggaggaggacgatgctcccgccgtcatctcggacttcatctaccagggcgccagcctg
cacaaccagactgaccgcacgggcgagaccgccctgcacctggctgccaggtactcccgc
tccgacgctgccaagcgcctgctggaggccagcgctgatgccaacatccaggacaacatg
ggccggacgcccctccacgccgccgtctctgccgatgcccaaggagtcttccagatcctg
attaggaacagggcaacagacctggatgcccgaatgcatgacgggaccactcccctgatc
ctggctgctcgcttggctgtggaggggatgctggatgacctcatcaactgccacgctgac
gtcaacgccgtggatgatttaggcaagtcagccctgcactgggcagctgctgtgaataat
gtggaagctgcaatggtcctcctgaaaaatggtgccaataaggacatgcagaataataag
gaggagaccccactgttcctggcagccagagaagggagctacgaaaccgccaaggtcctt
ctggaccattttgccaaccgggacatcacggaccacatggaccggctgccgcgggacatc
gcccaggagcgcatgcaccacgacatcgtgcggctgctggatgagtacaacctggtgcgg
agccccaccctgcacaacggccccctgggggcacccaccctgtcccccccgctctgctcc
cccaacagctacatcggcaacctcaaacccgccgtgcagggcaagaaggccaggaagcca
agcaccaaagggctgagctgcaatggcaaggatgccaaagacctcaaagcccggaggaaa
aagtcccaggatggaaaaggctgtctgcttgacaactccagcgtgttgtctccagtggac
tccctggagtcaccgcacggctacctctcggacgtggcctctcccccgctgatgacctct
ccgttccagcagtccccttccatgcccctgaaccacctgccaggcatgcccgatgcccac
ctgagcatcaaccacctcaacatggcgggcaagcaggatatggccatgggcagctccagc
aggatgggcttcgactcggtgccaccgcgcctgtcccacctgccggtgtccagccccagc
acggggatgagcagtgcccccatgagcttctcggtgggcggcggggccgggctgaacggg
cagtgtgactggctcacccggctgcagaacgggatggtgcagagccagtacaaccccctg
agagccaacctgcagcccggggcgcaccagcagccccaaaacctgcagcacggcatgatg
acctcgctgcacaacgggctgcccaccaccagcttgtcgcagatgatgagctaccaggcc
atgcccaacacccgcctggcgtcccagccccacctgatgcagagccagcagctccagcag
atgcagcagcagcagcagcagcagctccagcagcccaacctgcagccaccgcagcagcag
ccgcagcagccgcagcagcccccgcagccgccgcagcagccgcagcagcagcaccacaac
cccggctccaacgggagcggccacatgggccagaatttcctcggtacggagctgagccag
cccgacctgcagccggtgagcggcagcgccatggccgtgcacaccatcctgccccaggat
tcccagatgctgcccacctccctgccctcctccctcgcccagcccatgaccaccacgcag
ttcctgacgccgccttcccagcacagttattcctcccccttggacaacacccccagccac
cagctccaggtgcccgaccaccctttcctcacgccgtcaccggagtcgcccgaccagtgg
tccagctcctctcctcactccaacgtgtccgactggtccgagggcatctccagccctccc
acgagtatgcagtcacagatgggacacatccccgaggccttcaagtaa

DBGET integrated database retrieval system